Clone BO17161 Report

Search the DGRC for BO17161

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:171
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptCG33293-RA
Protein status:BO17161.pep: validated full length
Sequenced Size:292

Clone Sequence Records

BO17161.3prime Sequence

290 bp (290 high quality bases) assembled on 2006-10-13

> BO17161.3prime
ATGGTCTAGAAAGCTTGCAAGACCGCATTCAAAGGGCACAATGTAGTCGT
CTAGCAGCCGCACGCGGCGGAGTCTTCCTTGCGAGTCCACGCCCACGTCA
CCGCCACTGGATGCAGTCTGCTGTCCGACTTTGAGCCCCTCCTCCTCCTC
ATTCCTCAGCTCAACCTGGTGTCGCTGCACCACCAACATGCCGGCTGCTA
TTGCCGCCTCCTGGCGCAGCCATCCGGACATGATCCAGACACGGCGAATG
CAGGTTGTCAGTGCGAATCGTTCCATGTCGACTGATAACT

BO17161.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-PA 261 CG33293-RA 1..258 276..19 1290 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-RA 661 CG33293-RA 111..368 276..19 1290 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 18:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5240307..5240564 19..276 1290 100 Plus
Blast to na_te.dros performed on 2015-02-10 18:01:36 has no hits.

BO17161.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:03:31 Download gff for BO17161.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33293-PA 1..261 16..276 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:44:11 Download gff for BO17161.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 105..375 12..281 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:16:18 Download gff for BO17161.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 105..375 12..281 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:16:18 Download gff for BO17161.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 5240300..5240570 12..281 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:44:11 Download gff for BO17161.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1066022..1066292 12..281 97   Plus

BO17161.5prime Sequence

290 bp (290 high quality bases) assembled on 2006-10-13

> BO17161.5prime
GAAGTTATCAGTCGACATGGAACGATTCGCACTGACAACCTGCATTCGCC
GTGTCTGGATCATGTCCGGATGGCTGCGCCAGGAGGCGGCAATAGCAGCC
GGCATGTTGGTGGTGCAGCGACACCAGGTTGAGCTGAGGAATGAGGAGGA
GGAGGGGCTCAAAGTCGGACAGCAGACTGCATCCAGTGGCGGTGACGTGG
GCGTGGACTCGCAAGGAAGACTCCGCCGCGTGCGGCTGCTAGACGACTAC
ATTGTGCCCTTTGAATGCGGTCTTGCAAGCTTTCTAGACC

BO17161.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-PA 261 CG33293-RA 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-RA 661 CG33293-RA 111..368 17..274 1290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5240307..5240564 274..17 1290 100 Minus
Blast to na_te.dros performed on 2015-02-10 21:46:35 has no hits.

BO17161.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:03:32 Download gff for BO17161.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33293-PA 1..261 17..277 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:07:57 Download gff for BO17161.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 105..375 12..281 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:46:14 Download gff for BO17161.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 105..375 12..281 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:46:14 Download gff for BO17161.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 5240300..5240570 12..281 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:07:57 Download gff for BO17161.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1066022..1066292 12..281 97   Minus

BO17161.complete Sequence

292 bp assembled on 2006-10-11

GenBank Submission: FJ634048

> BO17161.complete
GAAGTTATCAGTCGACATGGAACGATTCGCACTGACAACCTGCATTCGCC
GTGTCTGGATCATGTCCGGATGGCTGCGCCAGGAGGCGGCAATAGCAGCC
GGCATGTTGGTGGTGCAGCGACACCAGGTTGAGCTGAGGAATGAGGAGGA
GGAGGGGCTCAAAGTCGGACAGCAGACTGCATCCAGTGGCGGTGACGTGG
GCGTGGACTCGCAAGGAAGACTCCGCCGCGTGCGGCTGCTAGACGACTAC
ATTGTGCCCTTTGAATGCGGTCTTGCAAGCTTTCTAGACCAT

BO17161.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:00:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-RA 261 CG33293-PA 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:00:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-RA 661 CG33293-RA 111..368 17..274 1290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 17:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5240307..5240564 274..17 1290 100 Minus
Blast to na_te.dros performed on 2014-11-27 17:00:43 has no hits.

BO17161.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:57:47 Download gff for BO17161.complete
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 1..261 17..277 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:19 Download gff for BO17161.complete
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 105..375 12..281 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:02:06 Download gff for BO17161.complete
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 111..368 17..276 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:57:47 Download gff for BO17161.complete
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 105..375 12..281 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:32:21 Download gff for BO17161.complete
Subject Subject Range Query Range Percent Splice Strand
CG33293-RA 111..368 17..276 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:32:21 Download gff for BO17161.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5240304..5240564 17..276 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:02:06 Download gff for BO17161.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1066026..1066286 17..276 99   Minus

BO17161.pep Sequence

Translation from 16 to 292

> BO17161.pep
MERFALTTCIRRVWIMSGWLRQEAAIAAGMLVVQRHQVELRNEEEEGLKV
GQQTASSGGDVGVDSQGRLRRVRLLDDYIVPFECGLASFLDH

BO17161.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG33293-PA 86 CG33293-PA 1..86 1..86 441 100 Plus