Clone BO17221 Report

Search the DGRC for BO17221

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:172
Well:21
Vector:pDNR-Dual
Associated Gene/Transcriptdro5-RA
Protein status:BO17221.pep:
Sequenced Size:241

Clone Sequence Records

BO17221.5prime Sequence

239 bp (239 high quality bases) assembled on 2006-10-13

> BO17221.5prime
GAAGTTATCAGTCGACATGCAGATCAAGTTCCTGTACCTCTTCCTGGCTG
TGATGACCATCTTCATCCTGGGCGCCAAGGAAGCCGATGCCGACTGTCTC
TCTGGAAGATACGGAGGACCCTGCGCCGTCTGGGACAACGAGACCTGTCG
TCGGGTGTGCAAGGAGGAAGGACGATCCAGTGGCCACTGCAGTCCCAGTC
TGAAGTGCTGGTGCGAGGGATGCGCAAGCTTTCTAGACC

BO17221.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG10812-PA 210 dro5-RA 1..207 17..223 1035 100 Plus
CG10810-PA 213 Drs-RA 106..210 119..223 375 94.2 Plus
CG32268-PA 219 dro6-RA 50..131 63..144 235 91.4 Plus
CG32279-PA 213 dro2-RA 165..210 178..223 180 95.6 Plus
CG32282-PA 216 dro4-RA 168..206 178..216 145 94.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:42:47
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl5-RA 364 CG10812-RA 53..261 15..223 1045 100 Plus
Drs-RA 387 CG10810-RA 116..273 66..223 550 89.9 Plus
Drsl6-RA 387 CG32268-RA 60..272 17..223 455 82.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3316833..3317041 15..223 1045 100 Plus
3L 28110227 3L 3369671..3369828 66..223 550 89.9 Plus
3L 28110227 3L 3314379..3314584 18..223 445 81.1 Plus
3L 28110227 3L 3336147..3336359 223..17 415 80.8 Minus
3L 28110227 3L 3315784..3315842 158..216 205 89.8 Plus
3L 28110227 3L 3335582..3335639 223..166 185 87.9 Minus
Blast to na_te.dros performed on 2015-02-11 17:42:43 has no hits.

BO17221.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:04:08 Download gff for BO17221.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10812-PA 1..210 17..224 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:24:36 Download gff for BO17221.5prime
Subject Subject Range Query Range Percent Splice Strand
Drsl5-RA 53..266 15..229 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:20:04 Download gff for BO17221.5prime
Subject Subject Range Query Range Percent Splice Strand
Drsl5-RA 53..266 15..229 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:20:04 Download gff for BO17221.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 3316833..3317046 15..229 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:24:36 Download gff for BO17221.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3316833..3317046 15..229 98   Plus

BO17221.3prime Sequence

239 bp (239 high quality bases) assembled on 2006-10-13

> BO17221.3prime
ATGGTCTAGAAAGCTTGCGCATCCCTCGCACCAGCACTTCAGACTGGGAC
TGCAGTGGCCACTGGATCGTCCTTCCTCCTTGCACACCCGACGACAGGTC
TCGTTGTCCCAGACGGCGCAGGGTCCTCCGTATCTTCCAGAGAGACAGTC
GGCATCGGCTTCCTTGGCGCCCAGGATGAAGATGGTCATCACAGCCAGGA
AGAGGTACAGGAACTTGATCTGCATGTCGACTGATAACT

BO17221.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG10812-PA 210 dro5-RA 1..207 225..19 1035 100 Minus
CG10810-PA 213 Drs-RA 106..210 123..19 375 94.2 Minus
CG32268-PA 219 dro6-RA 50..131 179..98 235 91.4 Minus
CG32279-PA 213 dro2-RA 165..210 64..19 180 95.6 Minus
CG32282-PA 216 dro4-RA 168..206 64..26 145 94.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl5-RA 364 CG10812-RA 53..261 227..19 1045 100 Minus
Drs-RA 387 CG10810-RA 116..273 176..19 550 89.9 Minus
Drsl6-RA 387 CG32268-RA 60..272 225..19 455 82.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:11:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3316833..3317041 227..19 1045 100 Minus
3L 28110227 3L 3369671..3369828 176..19 550 89.9 Minus
3L 28110227 3L 3314379..3314584 224..19 445 81.1 Minus
3L 28110227 3L 3336147..3336359 19..225 415 80.8 Plus
3L 28110227 3L 3315784..3315842 84..26 205 89.8 Minus
3L 28110227 3L 3335582..3335639 19..76 185 87.9 Plus
Blast to na_te.dros performed on 2015-02-08 12:11:22 has no hits.

BO17221.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:04:07 Download gff for BO17221.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10812-PA 1..210 18..225 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:40:35 Download gff for BO17221.3prime
Subject Subject Range Query Range Percent Splice Strand
Drsl5-RA 53..266 13..227 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:45:14 Download gff for BO17221.3prime
Subject Subject Range Query Range Percent Splice Strand
Drsl5-RA 53..266 13..227 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:45:14 Download gff for BO17221.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 3316833..3317046 13..227 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:40:35 Download gff for BO17221.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3316833..3317046 13..227 98   Minus

BO17221.complete Sequence

241 bp assembled on 2006-10-11

GenBank Submission: FJ634058

> BO17221.complete
GAAGTTATCAGTCGACATGCAGATCAAGTTCCTGTACCTCTTCCTGGCTG
TGATGACCATCTTCATCCTGGGCGCCAAGGAAGCCGATGCCGACTGTCTC
TCTGGAAGATACGGAGGACCCTGCGCCGTCTGGGACAACGAGACCTGTCG
TCGGGTGTGCAAGGAGGAAGGACGATCCAGTGGCCACTGCAGTCCCAGTC
TGAAGTGCTGGTGCGAGGGATGCGCAAGCTTTCTAGACCAT

BO17221.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl5-RA 210 CG10812-PA 1..207 17..223 1035 100 Plus
Drs-RA 213 CG10810-PA 53..210 66..223 550 89.9 Plus
Drsl2-RA 213 CG32279-PA 5..210 18..223 445 81.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl5-RA 364 CG10812-RA 53..261 15..223 1045 100 Plus
Drs-RA 387 CG10810-RA 116..273 66..223 550 89.9 Plus
Drsl2-RA 333 CG32279-RA 31..236 18..223 445 81.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3316833..3317041 15..223 1045 100 Plus
3L 28110227 3L 3369671..3369828 66..223 550 89.9 Plus
3L 28110227 3L 3314379..3314584 18..223 445 81.1 Plus
3L 28110227 3L 3336147..3336359 223..17 415 80.8 Minus
3L 28110227 3L 3315784..3315842 158..216 205 89.8 Plus
3L 28110227 3L 3335582..3335639 223..166 185 87.9 Minus
Blast to na_te.dros performed on 2014-11-26 15:51:21 has no hits.

BO17221.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:24:49 Download gff for BO17221.complete
Subject Subject Range Query Range Percent Splice Strand
dro5-RA 1..210 17..224 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:45:06 Download gff for BO17221.complete
Subject Subject Range Query Range Percent Splice Strand
dro5-RA 25..238 15..229 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:46:11 Download gff for BO17221.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl5-RA 55..261 17..225 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:24:50 Download gff for BO17221.complete
Subject Subject Range Query Range Percent Splice Strand
dro5-RA 25..238 15..229 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:05:11 Download gff for BO17221.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl5-RA 55..261 17..225 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:05:11 Download gff for BO17221.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3316835..3317041 17..225 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:46:11 Download gff for BO17221.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3316835..3317041 17..225 99   Plus

BO17221.pep Sequence

Translation from 16 to 241

> BO17221.pep
MQIKFLYLFLAVMTIFILGAKEADADCLSGRYGGPCAVWDNETCRRVCKE
EGRSSGHCSPSLKCWCEGCASFLDH

BO17221.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl5-PA 69 CG10812-PA 1..69 1..69 392 100 Plus
Drs-PA 70 CG10810-PA 2..70 1..69 338 82.6 Plus
Drsl2-PA 70 CG32279-PA 2..70 1..69 326 79.7 Plus
Drsl6-PA 72 CG32268-PA 2..72 1..69 316 78.9 Plus
Drsl1-PA 69 CG32274-PA 1..69 1..69 266 65.2 Plus