Clone Sequence Records
BO17304.5prime Sequence
263 bp (263 high quality bases) assembled on 2006-10-13
> BO17304.5prime
GAAGTTATCAGTCGACATGGCCAACACTCCAGCCACCTCCTCTGCCGGAC
CCGTGCTCCGTGGCCTCCACAATGCCACCATCAAGCGCAACCTGGCCGTT
TCCCTGGGCCTGACCGCCGTGGTGACCATCGCCTACAAAATTCTGGTCAA
CGATCCCAAGAAGGCCGCCTACGCCGACTTCTACTCGAAGTACGATGCCA
ACAAGTCCTTCGAGCGCATGAAGGCCGCCGGTCGTTTCCAGTCCTGCGCA
AGCTTTCTAGACC
BO17304.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 17:23:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14028-PA | 234 | cype-RA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:03:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cype-RC | 460 | CG14028-RC | 60..295 | 12..247 | 1180 | 100 | Plus |
cype-RA | 396 | CG14028-RA | 60..295 | 12..247 | 1180 | 100 | Plus |
cype-RB | 398 | CG14028-RB | 63..297 | 13..247 | 1175 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:02:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5327503..5327677 | 13..187 | 875 | 100 | Plus |
2L | 23513712 | 2L | 5327744..5327804 | 187..247 | 305 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-11 17:02:56 has no hits.
BO17304.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:05:05 Download gff for
BO17304.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14028-PA | 1..234 | 17..248 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 20:12:41 Download gff for
BO17304.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cype-RA | 60..301 | 12..254 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:02:47 Download gff for
BO17304.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cype-RA | 60..301 | 12..254 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:02:47 Download gff for
BO17304.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5327496..5327676 | 5..186 | 98 | -> | Plus |
2L | 5327744..5327810 | 187..254 | 95 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 20:12:41 Download gff for
BO17304.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5327496..5327676 | 5..186 | 98 | -> | Plus |
arm_2L | 5327744..5327810 | 187..254 | 95 | | Plus |
BO17304.3prime Sequence
263 bp (263 high quality bases) assembled on 2006-10-13
> BO17304.3prime
ATGGTCTAGAAAGCTTGCGCAGGACTGGAAACGACCGGCGGCCTTCATGC
GCTCGAAGGACTTGTTGGCATCGTACTTCGAGTAGAAGTCGGCGTAGGCG
GCCTTCTTGGGATCGTTGACCAGAATTTTGTAGGCGATGGTCACCACGGC
GGTCAGGCCCAGGGAAACGGCCAGGTTGCGCTTGATGGTGGCATTGTGGA
GGCCACGGAGCACGGGTCCGGCAGAGGAGGTGGCTGGAGTGTTGGCCATG
TCGACTGATAACT
BO17304.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 17:23:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14028-PA | 234 | cype-RA | 1..231 | 249..19 | 1155 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:58:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cype-RC | 460 | CG14028-RC | 60..295 | 254..19 | 1180 | 100 | Minus |
cype-RA | 396 | CG14028-RA | 60..295 | 254..19 | 1180 | 100 | Minus |
cype-RB | 398 | CG14028-RB | 63..297 | 253..19 | 1175 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:58:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5327503..5327677 | 253..79 | 875 | 100 | Minus |
2L | 23513712 | 2L | 5327744..5327804 | 79..19 | 305 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-13 06:58:30 has no hits.
BO17304.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:05:04 Download gff for
BO17304.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14028-PA | 1..234 | 18..249 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 21:30:16 Download gff for
BO17304.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cype-RA | 60..301 | 12..254 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:28:37 Download gff for
BO17304.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cype-RA | 60..301 | 12..254 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:28:37 Download gff for
BO17304.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5327494..5327676 | 80..263 | 97 | -> | Minus |
2L | 5327744..5327810 | 12..79 | 95 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 21:30:16 Download gff for
BO17304.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5327494..5327676 | 80..263 | 97 | -> | Minus |
arm_2L | 5327744..5327810 | 12..79 | 95 | | Minus |
BO17304.complete Sequence
265 bp assembled on 2008-08-15
GenBank Submission: FJ634072
> BO17304.complete
GAAGTTATCAGTCGACATGGCCAACACTCCAGCCACCTCCTCTGCCGGAC
CCGTGCTCCGTGGCCTCCACAATGCCACCATCAAGCGCAACCTGGCCGTT
TCCCTGGGCCTGACCGCCGTGGTGACCATCGCCTACAAAATTCTGGTCAA
CGATCCCAAGAAGGCCGCCTACGCCGACTTCTACTCGAAGTACGATGCCA
ACAAGTCCTTCGAGCGCATGAAGGCCGCCGGTCGTTTCCAGTCCTGCGCA
AGCTTTCTAGACCAT
BO17304.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:50:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cype-RC | 234 | CG14028-PC | 1..231 | 17..247 | 1155 | 100 | Plus |
cype-RB | 234 | CG14028-PB | 1..231 | 17..247 | 1155 | 100 | Plus |
cype-RA | 234 | CG14028-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:50:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cype-RC | 460 | CG14028-RC | 60..295 | 12..247 | 1180 | 100 | Plus |
cype-RA | 396 | CG14028-RA | 60..295 | 12..247 | 1180 | 100 | Plus |
cype-RB | 398 | CG14028-RB | 63..297 | 13..247 | 1175 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:50:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5327503..5327677 | 13..187 | 875 | 100 | Plus |
2L | 23513712 | 2L | 5327744..5327804 | 187..247 | 305 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 10:50:11 has no hits.
BO17304.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:02:57 Download gff for
BO17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cype-RA | 46..287 | 12..254 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:21:49 Download gff for
BO17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cype-RA | 65..295 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:17:06 Download gff for
BO17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cype-RA | 51..281 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:32:01 Download gff for
BO17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cype-RA | 65..295 | 17..249 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:32:01 Download gff for
BO17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5327507..5327676 | 17..186 | 100 | -> | Plus |
2L | 5327744..5327804 | 187..249 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:21:49 Download gff for
BO17304.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5327507..5327676 | 17..186 | 100 | -> | Plus |
arm_2L | 5327744..5327804 | 187..249 | 96 | | Plus |
BO17304.pep Sequence
Translation from 16 to 265
> BO17304.pep
MANTPATSSAGPVLRGLHNATIKRNLAVSLGLTAVVTIAYKILVNDPKKA
AYADFYSKYDANKSFERMKAAGRFQSCASFLDH
BO17304.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:30:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cype-PC | 77 | CG14028-PC | 1..77 | 1..77 | 388 | 100 | Plus |
cype-PB | 77 | CG14028-PB | 1..77 | 1..77 | 388 | 100 | Plus |
cype-PA | 77 | CG14028-PA | 1..77 | 1..77 | 388 | 100 | Plus |