Clone BO17304 Report

Search the DGRC for BO17304

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:173
Well:4
Vector:pDNR-Dual
Associated Gene/Transcriptcype-RA
Protein status:BO17304.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO17304.5prime Sequence

263 bp (263 high quality bases) assembled on 2006-10-13

> BO17304.5prime
GAAGTTATCAGTCGACATGGCCAACACTCCAGCCACCTCCTCTGCCGGAC
CCGTGCTCCGTGGCCTCCACAATGCCACCATCAAGCGCAACCTGGCCGTT
TCCCTGGGCCTGACCGCCGTGGTGACCATCGCCTACAAAATTCTGGTCAA
CGATCCCAAGAAGGCCGCCTACGCCGACTTCTACTCGAAGTACGATGCCA
ACAAGTCCTTCGAGCGCATGAAGGCCGCCGGTCGTTTCCAGTCCTGCGCA
AGCTTTCTAGACC

BO17304.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 17:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG14028-PA 234 cype-RA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
cype-RC 460 CG14028-RC 60..295 12..247 1180 100 Plus
cype-RA 396 CG14028-RA 60..295 12..247 1180 100 Plus
cype-RB 398 CG14028-RB 63..297 13..247 1175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5327503..5327677 13..187 875 100 Plus
2L 23513712 2L 5327744..5327804 187..247 305 100 Plus
Blast to na_te.dros performed on 2015-02-11 17:02:56 has no hits.

BO17304.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:05:05 Download gff for BO17304.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14028-PA 1..234 17..248 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 20:12:41 Download gff for BO17304.5prime
Subject Subject Range Query Range Percent Splice Strand
cype-RA 60..301 12..254 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:02:47 Download gff for BO17304.5prime
Subject Subject Range Query Range Percent Splice Strand
cype-RA 60..301 12..254 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:02:47 Download gff for BO17304.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 5327496..5327676 5..186 98 -> Plus
2L 5327744..5327810 187..254 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 20:12:41 Download gff for BO17304.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5327496..5327676 5..186 98 -> Plus
arm_2L 5327744..5327810 187..254 95   Plus

BO17304.3prime Sequence

263 bp (263 high quality bases) assembled on 2006-10-13

> BO17304.3prime
ATGGTCTAGAAAGCTTGCGCAGGACTGGAAACGACCGGCGGCCTTCATGC
GCTCGAAGGACTTGTTGGCATCGTACTTCGAGTAGAAGTCGGCGTAGGCG
GCCTTCTTGGGATCGTTGACCAGAATTTTGTAGGCGATGGTCACCACGGC
GGTCAGGCCCAGGGAAACGGCCAGGTTGCGCTTGATGGTGGCATTGTGGA
GGCCACGGAGCACGGGTCCGGCAGAGGAGGTGGCTGGAGTGTTGGCCATG
TCGACTGATAACT

BO17304.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 17:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14028-PA 234 cype-RA 1..231 249..19 1155 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
cype-RC 460 CG14028-RC 60..295 254..19 1180 100 Minus
cype-RA 396 CG14028-RA 60..295 254..19 1180 100 Minus
cype-RB 398 CG14028-RB 63..297 253..19 1175 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5327503..5327677 253..79 875 100 Minus
2L 23513712 2L 5327744..5327804 79..19 305 100 Minus
Blast to na_te.dros performed on 2015-02-13 06:58:30 has no hits.

BO17304.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:05:04 Download gff for BO17304.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14028-PA 1..234 18..249 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 21:30:16 Download gff for BO17304.3prime
Subject Subject Range Query Range Percent Splice Strand
cype-RA 60..301 12..254 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:28:37 Download gff for BO17304.3prime
Subject Subject Range Query Range Percent Splice Strand
cype-RA 60..301 12..254 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:28:37 Download gff for BO17304.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 5327494..5327676 80..263 97 -> Minus
2L 5327744..5327810 12..79 95   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 21:30:16 Download gff for BO17304.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5327494..5327676 80..263 97 -> Minus
arm_2L 5327744..5327810 12..79 95   Minus

BO17304.complete Sequence

265 bp assembled on 2008-08-15

GenBank Submission: FJ634072

> BO17304.complete
GAAGTTATCAGTCGACATGGCCAACACTCCAGCCACCTCCTCTGCCGGAC
CCGTGCTCCGTGGCCTCCACAATGCCACCATCAAGCGCAACCTGGCCGTT
TCCCTGGGCCTGACCGCCGTGGTGACCATCGCCTACAAAATTCTGGTCAA
CGATCCCAAGAAGGCCGCCTACGCCGACTTCTACTCGAAGTACGATGCCA
ACAAGTCCTTCGAGCGCATGAAGGCCGCCGGTCGTTTCCAGTCCTGCGCA
AGCTTTCTAGACCAT

BO17304.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
cype-RC 234 CG14028-PC 1..231 17..247 1155 100 Plus
cype-RB 234 CG14028-PB 1..231 17..247 1155 100 Plus
cype-RA 234 CG14028-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
cype-RC 460 CG14028-RC 60..295 12..247 1180 100 Plus
cype-RA 396 CG14028-RA 60..295 12..247 1180 100 Plus
cype-RB 398 CG14028-RB 63..297 13..247 1175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5327503..5327677 13..187 875 100 Plus
2L 23513712 2L 5327744..5327804 187..247 305 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:50:11 has no hits.

BO17304.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:02:57 Download gff for BO17304.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 46..287 12..254 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:21:49 Download gff for BO17304.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 65..295 17..249 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:17:06 Download gff for BO17304.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 51..281 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:32:01 Download gff for BO17304.complete
Subject Subject Range Query Range Percent Splice Strand
cype-RA 65..295 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:32:01 Download gff for BO17304.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5327507..5327676 17..186 100 -> Plus
2L 5327744..5327804 187..249 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:21:49 Download gff for BO17304.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5327507..5327676 17..186 100 -> Plus
arm_2L 5327744..5327804 187..249 96   Plus

BO17304.pep Sequence

Translation from 16 to 265

> BO17304.pep
MANTPATSSAGPVLRGLHNATIKRNLAVSLGLTAVVTIAYKILVNDPKKA
AYADFYSKYDANKSFERMKAAGRFQSCASFLDH

BO17304.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
cype-PC 77 CG14028-PC 1..77 1..77 388 100 Plus
cype-PB 77 CG14028-PB 1..77 1..77 388 100 Plus
cype-PA 77 CG14028-PA 1..77 1..77 388 100 Plus