Clone BO17311 Report

Search the DGRC for BO17311

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:173
Well:11
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO17311.pep: validated full length
Sequenced Size:412

Clone Sequence Records

BO17311.3prime Sequence

410 bp (410 high quality bases) assembled on 2006-10-13

> BO17311.3prime
ATGGTCTAGAAAGCTTGCGCCAAGATACTGCCACTGCGATGGGTATGAGA
TGCAGCTGGCAACCATTAGTGTGTAAATTTTTACTAGAATTGCACATATC
TTCCTCACAAAAGCACATACGTCCACTGCCTGAACCTTCCACCATGCACA
CGTGATCGACCATGAATAAATTGATCTGTAACTGTGACGTACACATGCGT
CGCACCACCTTGGCAGGGCTGTATAGTTGAAAGGATCCTTGCAGCGGGCA
TCAGTCCAGGAGTCGCACTCATAGCAGTAAATCGATCGCGTTTGACATTC
GGCTGAGGTCTGCGGAATCCATATGAAAGTTAGAAATCCGATAACGGCTG
TTAATACCAACAGCCAATTGCCAACTGCATTTCTCTGCGTCCACATGTCG
ACTGATAACT

BO17311.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG33472-PA 255 CG33472-RA 1..254 396..143 1270 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
qvr-RB 5055 CG33472-RB 725..913 396..208 945 100 Minus
qvr-RB 5055 CG33472-RB 984..1175 210..19 900 97.9 Minus
qvr-RC 5046 CG33472-RC 975..1166 210..19 900 97.9 Minus
qvr-RC 5046 CG33472-RC 725..904 396..208 455 84.1 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11447533..11447724 210..19 900 97.9 Minus
2R 25286936 2R 11446130..11446189 350..291 300 100 Minus
2R 25286936 2R 11447156..11447209 290..237 270 100 Minus
2R 25286936 2R 11444712..11444760 396..348 245 100 Minus
Blast to na_te.dros performed on 2015-02-12 11:20:59 has no hits.

BO17311.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:05:09 Download gff for BO17311.3prime
Subject Subject Range Query Range Percent Splice Strand
CG33472-PA 1..255 142..396 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:47:54 Download gff for BO17311.3prime
Subject Subject Range Query Range Percent Splice Strand
qvr-RB 725..912 209..396 100 -> Minus
qvr-RB 986..1178 15..208 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:40:52 Download gff for BO17311.3prime
Subject Subject Range Query Range Percent Splice Strand
qvr-RB 725..912 209..396 100 -> Minus
qvr-RB 986..1178 15..208 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:40:52 Download gff for BO17311.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 11444712..11444760 348..396 100 -> Minus
2R 11446133..11446189 291..347 100 -> Minus
2R 11447156..11447208 238..290 100 -> Minus
2R 11447270..11447298 209..237 100 -> Minus
2R 11447535..11447727 15..208 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:47:54 Download gff for BO17311.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7332217..7332265 348..396 100 -> Minus
arm_2R 7333638..7333694 291..347 100 -> Minus
arm_2R 7334661..7334713 238..290 100 -> Minus
arm_2R 7334775..7334803 209..237 100 -> Minus
arm_2R 7335040..7335232 15..208 96   Minus

BO17311.5prime Sequence

410 bp (410 high quality bases) assembled on 2006-10-13

> BO17311.5prime
GAAGTTATCAGTCGACATGTGGACGCAGAGAAATGCAGTTGGCAATTGGC
TGTTGGTATTAACAGCCGTTATCGGATTTCTAACTTTCATATGGATTCCG
CAGACCTCAGCCGAATGTCAAACGCGATCGATTTACTGCTATGAGTGCGA
CTCCTGGACTGATGCCCGCTGCAAGGATCCTTTCAACTATACAGCCCTGC
CAAGGTGGTGCGACGCATGTGTACGTCACAGTTACAGATCAATTTATTCA
TGGTCGATCACGTGTGCATGGTGGAAGGTTCAGGCAGTGGACGTATGTGC
TTTTGTGAGGAAGATATGTGCAATTCTAGTAAAAATTTACACACTAATGG
TTGCCAGCTGCATCTCATACCCATCGCAGTGGCAGTATCTTGGCGCAAGC
TTTCTAGACC

BO17311.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:13:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG33472-PA 255 CG33472-RA 1..254 17..270 1270 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 18:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
qvr-RB 5055 CG33472-RB 725..913 17..205 945 100 Plus
qvr-RB 5055 CG33472-RB 984..1175 203..394 900 97.9 Plus
qvr-RC 5046 CG33472-RC 975..1166 203..394 900 97.9 Plus
qvr-RC 5046 CG33472-RC 725..904 17..205 455 84.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 18:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11447533..11447724 203..394 900 97.9 Plus
2R 25286936 2R 11446130..11446189 63..122 300 100 Plus
2R 25286936 2R 11447156..11447209 123..176 270 100 Plus
2R 25286936 2R 11444712..11444760 17..65 245 100 Plus
Blast to na_te.dros performed on 2015-01-30 18:03:45 has no hits.

BO17311.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:05:10 Download gff for BO17311.5prime
Subject Subject Range Query Range Percent Splice Strand
CG33472-PA 1..255 17..271 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 18:53:31 Download gff for BO17311.5prime
Subject Subject Range Query Range Percent Splice Strand
qvr-RB 986..1178 205..398 96   Plus
qvr-RB 725..912 17..204 100 -> Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 20:07:59 Download gff for BO17311.5prime
Subject Subject Range Query Range Percent Splice Strand
qvr-RB 725..912 17..204 100 -> Plus
qvr-RB 986..1178 205..398 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 20:07:59 Download gff for BO17311.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 11444712..11444760 17..65 100 -> Plus
2R 11446133..11446189 66..122 100 -> Plus
2R 11447156..11447208 123..175 100 -> Plus
2R 11447270..11447298 176..204 100 -> Plus
2R 11447535..11447727 205..398 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 18:53:31 Download gff for BO17311.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7332217..7332265 17..65 100 -> Plus
arm_2R 7333638..7333694 66..122 100 -> Plus
arm_2R 7334661..7334713 123..175 100 -> Plus
arm_2R 7334775..7334803 176..204 100 -> Plus
arm_2R 7335040..7335232 205..398 96   Plus

BO17311.complete Sequence

412 bp assembled on 2006-10-11

GenBank Submission: FJ634075

> BO17311.complete
GAAGTTATCAGTCGACATGTGGACGCAGAGAAATGCAGTTGGCAATTGGC
TGTTGGTATTAACAGCCGTTATCGGATTTCTAACTTTCATATGGATTCCG
CAGACCTCAGCCGAATGTCAAACGCGATCGATTTACTGCTATGAGTGCGA
CTCCTGGACTGATGCCCGCTGCAAGGATCCTTTCAACTATACAGCCCTGC
CAAGGTGGTGCGACGCATGTGTACGTCACAGTTACAGATCAATTTATTCA
TGGTCGATCACGTGTGCATGGTGGAAGGTTCAGGCAGTGGACGTATGTGC
TTTTGTGAGGAAGATATGTGCAATTCTAGTAAAAATTTACACACTAATGG
TTGCCAGCTGCATCTCATACCCATCGCAGTGGCAGTATCTTGGCGCAAGC
TTTCTAGACCAT

BO17311.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
qvr-RB 477 CG33472-PB 1..189 17..205 945 100 Plus
qvr-RB 477 CG33472-PB 260..451 203..394 900 97.9 Plus
qvr-RC 468 CG33472-PC 251..442 203..394 900 97.9 Plus
qvr-RC 468 CG33472-PC 96..180 121..205 425 100 Plus
qvr-RC 468 CG33472-PC 1..49 17..65 245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
qvr-RB 5055 CG33472-RB 725..913 17..205 945 100 Plus
qvr-RB 5055 CG33472-RB 984..1175 203..394 900 97.9 Plus
qvr-RC 5046 CG33472-RC 975..1166 203..394 900 97.9 Plus
qvr-RC 5046 CG33472-RC 820..904 121..205 425 100 Plus
qvr-RC 5046 CG33472-RC 725..773 17..65 245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11447533..11447724 203..394 900 97.9 Plus
2R 25286936 2R 11446130..11446189 63..122 300 100 Plus
2R 25286936 2R 11447156..11447209 123..176 270 100 Plus
2R 25286936 2R 11444712..11444760 17..65 245 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:52:14 has no hits.

BO17311.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:24:45 Download gff for BO17311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33472-RA 1..255 17..271 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:45:01 Download gff for BO17311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33472-RA 704..1084 17..398 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:34:21 Download gff for BO17311.complete
Subject Subject Range Query Range Percent Splice Strand
qvr-RB 725..912 17..204 100 -> Plus
qvr-RB 986..1175 205..396 96   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:24:45 Download gff for BO17311.complete
Subject Subject Range Query Range Percent Splice Strand
CG33472-RA 704..1084 17..398 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:28:22 Download gff for BO17311.complete
Subject Subject Range Query Range Percent Splice Strand
qvr-RB 725..912 17..204 100 -> Plus
qvr-RB 986..1175 205..396 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:28:22 Download gff for BO17311.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11444712..11444760 17..65 100 -> Plus
2R 11446133..11446189 66..122 100 -> Plus
2R 11447156..11447208 123..175 100 -> Plus
2R 11447270..11447298 176..204 100 -> Plus
2R 11447535..11447724 205..396 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:34:21 Download gff for BO17311.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7332217..7332265 17..65 100 -> Plus
arm_2R 7333638..7333694 66..122 100 -> Plus
arm_2R 7334661..7334713 123..175 100 -> Plus
arm_2R 7334775..7334803 176..204 100 -> Plus
arm_2R 7335040..7335229 205..396 96   Plus

BO17311.pep Sequence

Translation from 16 to 412

> BO17311.pep
MWTQRNAVGNWLLVLTAVIGFLTFIWIPQTSAECQTRSIYCYECDSWTDA
RCKDPFNYTALPRWCDACVRHSYRSIYSWSITCAWWKVQAVDVCAFVRKI
CAILVKIYTLMVASCISYPSQWQYLGASFLDH

BO17311.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
qvr-PB 158 CG33472-PB 1..86 1..77 361 81.6 Plus
qvr-PC 155 CG33472-PC 1..83 1..77 248 62.5 Plus