Clone BO17381 Report

Search the DGRC for BO17381

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:173
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG32266-RA
Protein status:BO17381.pep:
Sequenced Size:265

Clone Sequence Records

BO17381.3prime Sequence

263 bp (263 high quality bases) assembled on 2006-10-13

> BO17381.3prime
ATGGTCTAGAAAGCTTGCGCGTCTCAGGTACAGCGAGCTGTAGGGATAGG
CTCCGTAGGCGTAGGGCGTGGCGGCATAGACGCCGCTGGTGTAGGCAGCA
CTGTACGTGGGTGCGTAGAGTCCGCCCGAGTAGGCGTAGGGCGTGGCAGC
AACCACAGGCGAGGCCGCACTGTAGGCGGTCAGGAATTGCGGCTTGCCAC
AGGCAACGGCCAACAGGGCGAACAGGCACAGAGCGAAAAACTTGAACATG
TCGACTGATAACT

BO17381.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:14:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-PA 234 CG32266-RA 1..231 249..19 1155 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-RA 526 CG32266-RA 41..271 249..19 1155 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3791087..3791305 237..19 1095 100 Minus
Blast to na_te.dros performed on 2015-02-11 17:43:56 has no hits.

BO17381.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:06:21 Download gff for BO17381.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32266-PA 1..234 16..249 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:24:52 Download gff for BO17381.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 30..278 11..259 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:25:21 Download gff for BO17381.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 30..278 11..259 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:25:21 Download gff for BO17381.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 3791087..3791312 11..237 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:24:52 Download gff for BO17381.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3791087..3791312 11..237 98   Minus

BO17381.5prime Sequence

263 bp (263 high quality bases) assembled on 2006-10-13

> BO17381.5prime
GAAGTTATCAGTCGACATGTTCAAGTTTTTCGCTCTGTGCCTGTTCGCCC
TGTTGGCCGTTGCCTGTGGCAAGCCGCAATTCCTGACCGCCTACAGTGCG
GCCTCGCCTGTGGTTGCTGCCACGCCCTACGCCTACTCGGGCGGACTCTA
CGCACCCACGTACAGTGCTGCCTACACCAGCGGCGTCTATGCCGCCACGC
CCTACGCCTACGGAGCCTATCCCTACAGCTCGCTGTACCTGAGACGCGCA
AGCTTTCTAGACC

BO17381.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-PA 234 CG32266-RA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-RA 526 CG32266-RA 41..271 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3791087..3791305 29..247 1095 100 Plus
Blast to na_te.dros performed on 2015-02-10 21:50:17 has no hits.

BO17381.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:06:23 Download gff for BO17381.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32266-PA 1..234 17..250 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:08:18 Download gff for BO17381.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 30..278 7..255 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:46:50 Download gff for BO17381.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 30..278 7..255 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:46:50 Download gff for BO17381.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 3791087..3791312 29..255 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:08:18 Download gff for BO17381.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3791087..3791312 29..255 98   Plus

BO17381.complete Sequence

265 bp assembled on 2006-10-11

GenBank Submission: FJ634102

> BO17381.complete
GAAGTTATCAGTCGACATGTTCAAGTTTTTCGCTCTGTGCCTGTTCGCCC
TGTTGGCCGTTGCCTGTGGCAAGCCGCAATTCCTGACCGCCTACAGTGCG
GCCTCGCCTGTGGTTGCTGCCACGCCCTACGCCTACTCGGGCGGACTCTA
CGCACCCACGTACAGTGCTGCCTACACCAGCGGCGTCTATGCCGCCACGC
CCTACGCCTACGGAGCCTATCCCTACAGCTCGCTGTACCTGAGACGCGCA
AGCTTTCTAGACCAT

BO17381.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-RA 234 CG32266-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-RA 526 CG32266-RA 41..271 17..247 1155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3791087..3791305 29..247 1095 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:30:28 has no hits.

BO17381.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:46:51 Download gff for BO17381.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 1..234 17..250 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:01:09 Download gff for BO17381.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 30..278 7..255 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:53:59 Download gff for BO17381.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 46..271 22..249 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:46:51 Download gff for BO17381.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 30..278 7..255 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:14:31 Download gff for BO17381.complete
Subject Subject Range Query Range Percent Splice Strand
CG32266-RA 46..271 22..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:14:31 Download gff for BO17381.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3791083..3791305 22..249 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:53:59 Download gff for BO17381.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3791083..3791305 22..249 97   Plus

BO17381.pep Sequence

Translation from 16 to 265

> BO17381.pep
MFKFFALCLFALLAVACGKPQFLTAYSAASPVVAATPYAYSGGLYAPTYS
AAYTSGVYAATPYAYGAYPYSSLYLRRASFLDH

BO17381.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG32266-PA 77 CG32266-PA 1..77 1..77 403 100 Plus
CG13067-PA 79 CG13067-PA 1..78 1..74 150 50 Plus
CG13069-PA 97 CG13069-PA 1..79 1..70 135 40.5 Plus