Clone Sequence Records
BO17381.3prime Sequence
263 bp (263 high quality bases) assembled on 2006-10-13
> BO17381.3prime
ATGGTCTAGAAAGCTTGCGCGTCTCAGGTACAGCGAGCTGTAGGGATAGG
CTCCGTAGGCGTAGGGCGTGGCGGCATAGACGCCGCTGGTGTAGGCAGCA
CTGTACGTGGGTGCGTAGAGTCCGCCCGAGTAGGCGTAGGGCGTGGCAGC
AACCACAGGCGAGGCCGCACTGTAGGCGGTCAGGAATTGCGGCTTGCCAC
AGGCAACGGCCAACAGGGCGAACAGGCACAGAGCGAAAAACTTGAACATG
TCGACTGATAACT
BO17381.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:14:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32266-PA | 234 | CG32266-RA | 1..231 | 249..19 | 1155 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:43:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32266-RA | 526 | CG32266-RA | 41..271 | 249..19 | 1155 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:43:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3791087..3791305 | 237..19 | 1095 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-11 17:43:56 has no hits.
BO17381.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:06:21 Download gff for
BO17381.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32266-PA | 1..234 | 16..249 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:24:52 Download gff for
BO17381.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32266-RA | 30..278 | 11..259 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:25:21 Download gff for
BO17381.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32266-RA | 30..278 | 11..259 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:25:21 Download gff for
BO17381.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3791087..3791312 | 11..237 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:24:52 Download gff for
BO17381.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3791087..3791312 | 11..237 | 98 | | Minus |
BO17381.5prime Sequence
263 bp (263 high quality bases) assembled on 2006-10-13
> BO17381.5prime
GAAGTTATCAGTCGACATGTTCAAGTTTTTCGCTCTGTGCCTGTTCGCCC
TGTTGGCCGTTGCCTGTGGCAAGCCGCAATTCCTGACCGCCTACAGTGCG
GCCTCGCCTGTGGTTGCTGCCACGCCCTACGCCTACTCGGGCGGACTCTA
CGCACCCACGTACAGTGCTGCCTACACCAGCGGCGTCTATGCCGCCACGC
CCTACGCCTACGGAGCCTATCCCTACAGCTCGCTGTACCTGAGACGCGCA
AGCTTTCTAGACC
BO17381.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:14:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32266-PA | 234 | CG32266-RA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:50:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32266-RA | 526 | CG32266-RA | 41..271 | 17..247 | 1155 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:50:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3791087..3791305 | 29..247 | 1095 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 21:50:17 has no hits.
BO17381.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:06:23 Download gff for
BO17381.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32266-PA | 1..234 | 17..250 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:08:18 Download gff for
BO17381.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32266-RA | 30..278 | 7..255 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:46:50 Download gff for
BO17381.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32266-RA | 30..278 | 7..255 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:46:50 Download gff for
BO17381.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3791087..3791312 | 29..255 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:08:18 Download gff for
BO17381.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3791087..3791312 | 29..255 | 98 | | Plus |
BO17381.complete Sequence
265 bp assembled on 2006-10-11
GenBank Submission: FJ634102
> BO17381.complete
GAAGTTATCAGTCGACATGTTCAAGTTTTTCGCTCTGTGCCTGTTCGCCC
TGTTGGCCGTTGCCTGTGGCAAGCCGCAATTCCTGACCGCCTACAGTGCG
GCCTCGCCTGTGGTTGCTGCCACGCCCTACGCCTACTCGGGCGGACTCTA
CGCACCCACGTACAGTGCTGCCTACACCAGCGGCGTCTATGCCGCCACGC
CCTACGCCTACGGAGCCTATCCCTACAGCTCGCTGTACCTGAGACGCGCA
AGCTTTCTAGACCAT
BO17381.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:30:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32266-RA | 234 | CG32266-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:30:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32266-RA | 526 | CG32266-RA | 41..271 | 17..247 | 1155 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:30:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3791087..3791305 | 29..247 | 1095 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:30:28 has no hits.
BO17381.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:46:51 Download gff for
BO17381.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32266-RA | 1..234 | 17..250 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:01:09 Download gff for
BO17381.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32266-RA | 30..278 | 7..255 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:53:59 Download gff for
BO17381.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32266-RA | 46..271 | 22..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:46:51 Download gff for
BO17381.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32266-RA | 30..278 | 7..255 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:14:31 Download gff for
BO17381.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32266-RA | 46..271 | 22..249 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:14:31 Download gff for
BO17381.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3791083..3791305 | 22..249 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:53:59 Download gff for
BO17381.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3791083..3791305 | 22..249 | 97 | | Plus |
BO17381.pep Sequence
Translation from 16 to 265
> BO17381.pep
MFKFFALCLFALLAVACGKPQFLTAYSAASPVVAATPYAYSGGLYAPTYS
AAYTSGVYAATPYAYGAYPYSSLYLRRASFLDH
BO17381.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:35:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32266-PA | 77 | CG32266-PA | 1..77 | 1..77 | 403 | 100 | Plus |
CG13067-PA | 79 | CG13067-PA | 1..78 | 1..74 | 150 | 50 | Plus |
CG13069-PA | 97 | CG13069-PA | 1..79 | 1..70 | 135 | 40.5 | Plus |