Clone BO17408 Report

Search the DGRC for BO17408

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:174
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptBobA-RA
Protein status:BO17408.pep: validated full length
Sequenced Size:268

Clone Sequence Records

BO17408.5prime Sequence

266 bp (266 high quality bases) assembled on 2006-10-13

> BO17408.5prime
GAAGTTATCAGTCGACATGTTCACCGAAACCGCTCTTGTTTCCAACTTCA
ATGGAGTGACAGAGAAGAAATCTCTTACCGGCGCCTCCACCAACCTGAAG
AAGCTGCTGAAGACCATCAAGAAGGTCTTCAAGAACTCCAAGCCTTCGAA
GGAGATTCCGATCCCCAACATCATCTACTCTTGCAATACTGAGGAGGAGC
ACCAGAATTGGCTCAACGAACAACTGGAGGCCATGGCAATCCATCTTCAC
GCAAGCTTTCTAGACC

BO17408.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG12487-PA 237 BobA-RA 1..234 17..250 1170 100 Plus
CG13465-PA 237 CG13465-RA 8..234 24..250 1110 99.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 10:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
BobA-RA 627 CG12487-RA 58..291 17..250 1170 100 Plus
CG13465-RA 602 CG13465-RA 40..273 17..250 1125 98.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14945835..14946068 250..17 1170 100 Minus
3L 28110227 3L 14944059..14944292 250..17 1125 98.7 Minus
Blast to na_te.dros performed on 2015-02-06 10:38:14 has no hits.

BO17408.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:06:40 Download gff for BO17408.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12487-PA 1..237 17..253 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:43:42 Download gff for BO17408.5prime
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 58..297 17..258 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:27:57 Download gff for BO17408.5prime
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 58..297 17..258 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:27:57 Download gff for BO17408.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 14945829..14946068 17..258 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:43:42 Download gff for BO17408.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14938929..14939168 17..258 98   Minus

BO17408.3prime Sequence

266 bp (266 high quality bases) assembled on 2006-10-13

> BO17408.3prime
ATGGTCTAGAAAGCTTGCGTGAAGATGGATTGCCATGGCCTCCAGTTGTT
CGTTGAGCCAATTCTGGTGCTCCTCCTCAGTATTGCAAGAGTAGATGATG
TTGGGGATCGGAATCTCCTTCGAAGGCTTGGAGTTCTTGAAGACCTTCTT
GATGGTCTTCAGCAGCTTCTTCAGGTTGGTGGAGGCGCCGGTAAGAGATT
TCTTCTCTGTCACTCCATTGAAGTTGGAAACAAGAGCGGTTTCGGTGAAC
ATGTCGACTGATAACT

BO17408.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG12487-PA 237 BobA-RA 1..234 252..19 1170 100 Minus
CG13465-PA 237 CG13465-RA 8..234 245..19 1110 99.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
BobA-RA 627 CG12487-RA 58..291 252..19 1170 100 Minus
CG13465-RA 602 CG13465-RA 40..273 252..19 1125 98.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14945835..14946068 19..252 1170 100 Plus
3L 28110227 3L 14944059..14944292 19..252 1125 98.7 Plus
Blast to na_te.dros performed on 2015-02-11 17:44:35 has no hits.

BO17408.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:06:40 Download gff for BO17408.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12487-PA 1..237 16..252 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:25:00 Download gff for BO17408.3prime
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 58..297 11..252 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:26:54 Download gff for BO17408.3prime
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 58..297 11..252 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:26:54 Download gff for BO17408.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 14945829..14946068 11..252 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:25:00 Download gff for BO17408.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14938929..14939168 11..252 98   Plus

BO17408.complete Sequence

268 bp assembled on 2006-10-11

GenBank Submission: FJ634109

> BO17408.complete
GAAGTTATCAGTCGACATGTTCACCGAAACCGCTCTTGTTTCCAACTTCA
ATGGAGTGACAGAGAAGAAATCTCTTACCGGCGCCTCCACCAACCTGAAG
AAGCTGCTGAAGACCATCAAGAAGGTCTTCAAGAACTCCAAGCCTTCGAA
GGAGATTCCGATCCCCAACATCATCTACTCTTGCAATACTGAGGAGGAGC
ACCAGAATTGGCTCAACGAACAACTGGAGGCCATGGCAATCCATCTTCAC
GCAAGCTTTCTAGACCAT

BO17408.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
BobA-RA 237 CG12487-PA 1..234 17..250 1170 100 Plus
CG13465-RA 237 CG13465-PA 1..234 17..250 1125 98.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
BobA-RA 627 CG12487-RA 58..291 17..250 1170 100 Plus
CG13465-RA 602 CG13465-RA 40..273 17..250 1125 98.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14945835..14946068 250..17 1170 100 Minus
3L 28110227 3L 14944059..14944292 250..17 1125 98.7 Minus
Blast to na_te.dros performed on 2014-11-27 20:31:50 has no hits.

BO17408.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:24:12 Download gff for BO17408.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 1..237 17..253 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:44:15 Download gff for BO17408.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 45..284 17..258 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:08:46 Download gff for BO17408.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 63..291 22..252 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:24:12 Download gff for BO17408.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 45..284 17..258 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:23:08 Download gff for BO17408.complete
Subject Subject Range Query Range Percent Splice Strand
BobA-RA 63..291 22..252 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:23:08 Download gff for BO17408.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14945832..14946063 22..252 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:08:46 Download gff for BO17408.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14938932..14939163 22..252 99   Minus

BO17408.pep Sequence

Translation from 16 to 268

> BO17408.pep
MFTETALVSNFNGVTEKKSLTGASTNLKKLLKTIKKVFKNSKPSKEIPIP
NIIYSCNTEEEHQNWLNEQLEAMAIHLHASFLDH

BO17408.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
BobA-PA 78 CG12487-PA 1..78 1..78 403 100 Plus
CG13465-PA 78 CG13465-PA 1..78 1..78 394 97.4 Plus