Clone BO17669 Report

Search the DGRC for BO17669

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:176
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptSec61beta-RA
Protein status:BO17669.pep: Imported from assembly
Sequenced Size:334

Clone Sequence Records

BO17669.3prime Sequence

332 bp (332 high quality bases) assembled on 2006-10-13

> BO17669.3prime
ATGGTCTAGAAAGCTTGCAGAACGATTGTATTTGCCCCAAATGTGCAGCA
TGAAGACGGAAGCGATGAACAGCAGCGACATGACCAGCACGGGTACGGGA
CCAACTTTGATACCGGGCGAGTCGTCCGTGTAGAAACGCCACATGCCACC
AGTTCCGGCTCCGCCGGGTGCACGGCTCCGGGCCGCTGTGGTGCTGGTGG
TGGTCTTGCGCTGCTTCAGGGTGCTGCCGCCTCCGGATCCGGCGCTACGT
GGCGCCGACAATTTGCTGGGGGAGCGCGATCCGCTGCCCACGGACGTTGA
ACTGGCTGGAGCGGGCATGTCGACTGATAACT

BO17669.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 18:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG10130-PA 303 Sec61beta-RA 1..300 318..19 1475 99.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-RA 792 CG10130-RA 130..429 318..19 1485 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14618958..14619170 316..104 1065 100 Minus
2R 25286936 2R 14619234..14619318 103..19 410 98.8 Minus
Blast to na_te.dros performed on 2015-02-12 16:33:05 has no hits.

BO17669.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:11:26 Download gff for BO17669.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10130-PA 1..303 15..318 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 17:02:28 Download gff for BO17669.3prime
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..434 13..318 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:40:33 Download gff for BO17669.3prime
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..434 13..318 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:40:33 Download gff for BO17669.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 14618949..14619170 104..326 98 -> Minus
2R 14619234..14619323 13..103 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 17:02:28 Download gff for BO17669.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10506739..10506828 13..103 96   Minus
arm_2R 10506454..10506675 104..326 98 -> Minus

BO17669.complete Sequence

334 bp assembled on 2011-06-28

GenBank Submission: KX794846

> BO17669.complete
GAAGTTATCAGTCGACATGCCCGCTCCAGCCAGTTCAACGTCCGTGGGCA
GCGGATCGCGCTCCCCCAGCAAATTGTCGGCGCCACGTAGCGCCGGATCC
GGAGGCGGCAGCACCCTGAAGCAGCGCAAGACCACCACCAGCACCACAGC
GGCCCGGAGCCGTGCACCCGGCGGAGCCGGAACTGGTGGCATGTGGCGTT
TCTACACGGACGACTCGCCCGGTATCAAAGTTGGTCCCGTACCCGTGCTG
GTCATGTCGCTGCTGTTCATCGCTTCCGTCTTCATGCTGCACATTTGGGG
CAAATACAATCGTTCTGCAAGCTTTCTAGACCAT

BO17669.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-RA 303 CG10130-PA 1..300 17..316 1485 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-RA 792 CG10130-RA 130..429 17..316 1485 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:04:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14618958..14619170 19..231 1065 100 Plus
2R 25286936 2R 14619234..14619318 232..316 410 98.8 Plus
Blast to na_te.dros performed on 2014-11-26 16:05:01 has no hits.

BO17669.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-06-28 12:16:03 Download gff for BO17669.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 174..473 17..318 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:51:55 Download gff for BO17669.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..429 17..318 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:10:49 Download gff for BO17669.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..429 17..318 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:10:49 Download gff for BO17669.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14618957..14619170 17..231 99 -> Plus
2R 14619234..14619318 232..318 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:51:55 Download gff for BO17669.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10506462..10506675 17..231 99 -> Plus
arm_2R 10506739..10506823 232..318 96   Plus

BO17669.pep Sequence

Translation from 16 to 334

> BO17669.pep
MPAPASSTSVGSGSRSPSKLSAPRSAGSGGGSTLKQRKTTTSTTAARSRA
PGGAGTGGMWRFYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYNRS
ASFLDH

BO17669.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-PA 100 CG10130-PA 1..100 1..100 514 100 Plus