Clone BO17749 Report

Search the DGRC for BO17749

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:177
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptsPLA2-RB
Protein status:BO17749.pep: validated full length
Sequenced Size:337

Clone Sequence Records

BO17749.3prime Sequence

335 bp (335 high quality bases) assembled on 2006-10-13

> BO17749.3prime
ATGGTCTAGAAAGCTTGCCATGGGAAACCAGTCTGTGTTGGTGGGCAGTC
CGTGGAGTGCTCCGTGGGACTCGATAATCTCGTCGCAATGGTCGTGGGCA
CGACAGCACTTGTCCGTCTCCCGTTCGCGGCCCAAATCCTCGAAGTTCGC
CGCCGTGTTGCCCGGTCCGCACCACTTGGTTCCGGGCACCGTGATGCCCG
TATGGGGAACTGGTGGCAGTGCCTGGTTGTAGATGTCCTCGTCCTCAAAG
ATAGCCTCGTCGCCGAAGGCCCAAGCCATGGCCAGTAGCCCAAAAAAGAA
CGCTTCGCGCAGCAGCCACATGTCGACTGATAACT

BO17749.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 18:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG11124-PB 306 sPLA2-RB 1..303 321..19 1515 100 Minus
CG11124-PA 561 sPLA2-RA 1..302 321..20 1510 100 Minus
CG11124-PC 561 sPLA2-RC 1..302 321..20 1510 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
sPLA2-RB 725 CG11124-RB 29..334 324..19 1530 100 Minus
sPLA2-RC 897 CG11124-RC 208..512 324..20 1525 100 Minus
sPLA2-RA 718 CG11124-RA 29..333 324..20 1525 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7443071..7443376 324..19 1530 100 Minus
Blast to na_te.dros performed on 2015-02-11 17:48:22 has no hits.

BO17749.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:12:26 Download gff for BO17749.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11124-PB 1..306 15..321 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 20:14:24 Download gff for BO17749.3prime
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 29..343 8..324 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:19:14 Download gff for BO17749.3prime
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 29..343 8..324 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:19:14 Download gff for BO17749.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 7443071..7443381 13..324 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 20:14:24 Download gff for BO17749.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3330576..3330886 13..324 99   Minus

BO17749.5prime Sequence

335 bp (335 high quality bases) assembled on 2006-10-13

> BO17749.5prime
GAAGTTATCAGTCGACATGTGGCTGCTGCGCGAAGCGTTCTTTTTTGGGC
TACTGGCCATGGCTTGGGCCTTCGGCGACGAGGCTATCTTTGAGGACGAG
GACATCTACAACCAGGCACTGCCACCAGTTCCCCATACGGGCATCACGGT
GCCCGGAACCAAGTGGTGCGGACCGGGCAACACGGCGGCGAACTTCGAGG
ATTTGGGCCGCGAACGGGAGACGGACAAGTGCTGTCGTGCCCACGACCAT
TGCGACGAGATTATCGAGTCCCACGGAGCACTCCACGGACTGCCCACCAA
CACAGACTGGTTTCCCATGGCAAGCTTTCTAGACC

BO17749.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 18:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG11124-PB 306 sPLA2-RB 1..303 17..319 1515 100 Plus
CG11124-PA 561 sPLA2-RA 1..302 17..318 1510 100 Plus
CG11124-PC 561 sPLA2-RC 1..302 17..318 1510 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
sPLA2-RB 725 CG11124-RB 29..334 14..319 1530 100 Plus
sPLA2-RC 897 CG11124-RC 208..512 14..318 1525 100 Plus
sPLA2-RA 718 CG11124-RA 29..333 14..318 1525 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 06:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7443071..7443376 14..319 1530 100 Plus
Blast to na_te.dros performed on 2015-02-12 06:09:03 has no hits.

BO17749.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:12:27 Download gff for BO17749.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11124-PB 1..306 17..323 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 07:11:00 Download gff for BO17749.5prime
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 29..343 14..330 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 08:00:51 Download gff for BO17749.5prime
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 29..343 14..330 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 08:00:51 Download gff for BO17749.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 7443071..7443381 14..325 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 07:11:00 Download gff for BO17749.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3330576..3330886 14..325 99   Plus

BO17749.complete Sequence

337 bp assembled on 2007-10-17

GenBank Submission: FJ634200

> BO17749.complete
GAAGTTATCAGTCGACATGTGGCTGCTGCGCGAAGCGTTCTTTTTTGGGC
TACTGGCCATGGCTTGGGCCTTCGGCGACGAGGCTATCTTTGAGGACGAG
GACATCTACAACCAGGCACTGCCACCAGTTCCCCATACGGGCATCACGGT
GCCCGGAACCAAGTGGTGCGGACCGGGCAACACGGCGGCGAACTTCGAGG
ATTTGGGCCGCGAACGGGAGACGGACAAGTGCTGTCGTGCCCACGACCAT
TGCGACGAGATTATCGAGTCCCACGGAGCACTCCACGGACTGCCCACCAA
CACAGACTGGTTTCCCATGGCAAGCTTTCTAGACCAT

BO17749.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
sPLA2-RB 306 CG11124-PB 1..303 17..319 1515 100 Plus
sPLA2-RC 561 CG11124-PC 1..302 17..318 1510 100 Plus
sPLA2-RA 561 CG11124-PA 1..302 17..318 1510 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
sPLA2-RB 725 CG11124-RB 29..334 14..319 1530 100 Plus
sPLA2-RC 897 CG11124-RC 208..512 14..318 1525 100 Plus
sPLA2-RA 718 CG11124-RA 29..333 14..318 1525 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7443071..7443376 14..319 1530 100 Plus
Blast to na_te.dros performed on 2014-11-27 23:39:32 has no hits.

BO17749.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:03:33 Download gff for BO17749.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 1..306 17..323 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:01:31 Download gff for BO17749.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 27..341 14..330 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:34:43 Download gff for BO17749.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 32..334 17..321 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:29:38 Download gff for BO17749.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 30..332 17..321 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:05:35 Download gff for BO17749.complete
Subject Subject Range Query Range Percent Splice Strand
sPLA2-RB 32..334 17..321 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:05:35 Download gff for BO17749.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7443074..7443376 17..321 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:34:43 Download gff for BO17749.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3330579..3330881 17..321 99   Plus

BO17749.pep Sequence

Translation from 16 to 337

> BO17749.pep
MWLLREAFFFGLLAMAWAFGDEAIFEDEDIYNQALPPVPHTGITVPGTKW
CGPGNTAANFEDLGRERETDKCCRAHDHCDEIIESHGALHGLPTNTDWFP
MASFLDH

BO17749.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
sPLA2-PB 101 CG11124-PB 1..101 1..101 578 100 Plus
sPLA2-PC 186 CG11124-PC 1..101 1..101 574 99 Plus
sPLA2-PA 186 CG11124-PA 1..101 1..101 574 99 Plus
CG30503-PB 173 CG30503-PB 26..85 43..103 201 62.3 Plus
CG30503-PA 173 CG30503-PA 26..85 43..103 201 62.3 Plus