Clone BO17769 Report

Search the DGRC for BO17769

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:177
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptSec61beta-RA
Protein status:BO17769.pep: validated full length
Sequenced Size:334

Clone Sequence Records

BO17769.3prime Sequence

332 bp (332 high quality bases) assembled on 2006-10-13

> BO17769.3prime
ATGGTCTAGAAAGCTTGCAGAACGATTGTATTTGCCCCAAATGTGCAGCA
TGAAGACGGAAGCGATGAACAGCAGCGACATGACCAGCACGGGTACGGGA
CCAACTTTGATACCGGGCGAGTCGTCCGTGTAGAAACGCCACATGCCACC
AGTTCCGGCTCCGCCGGGTGCACGGCTCCGGGCCGCTGTGGTGCTGGTGG
TGGTCTTGCGCTGCTTCAGGGTGCTGCCGCCTCCGGATCCGGCGCTACGT
GGCGCCGACAATTTGCTGGGGGAGCGCGATCCGCTGCCCACGGACGTTGA
ACTGGCTGGAGCGGGCATGTCGACTGATAACT

BO17769.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 18:11:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG10130-PA 303 Sec61beta-RA 1..300 318..19 1475 99.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 00:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-RA 792 CG10130-RA 130..429 318..19 1485 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 00:38:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14618958..14619170 316..104 1065 100 Minus
2R 25286936 2R 14619234..14619318 103..19 410 98.8 Minus
Blast to na_te.dros performed on 2015-02-13 00:38:16 has no hits.

BO17769.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:12:49 Download gff for BO17769.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10130-PA 1..303 15..318 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 22:41:52 Download gff for BO17769.3prime
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..434 13..318 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:51:34 Download gff for BO17769.3prime
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..434 13..318 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:51:34 Download gff for BO17769.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 14618949..14619170 104..326 98 -> Minus
2R 14619234..14619323 13..103 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 22:41:52 Download gff for BO17769.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10506454..10506675 104..326 98 -> Minus
arm_2R 10506739..10506828 13..103 96   Minus

BO17769.5prime Sequence

332 bp (332 high quality bases) assembled on 2006-10-13

> BO17769.5prime
GAAGTTATCAGTCGACATGCCCGCTCCAGCCAGTTCAACGTCCGTGGGCA
GCGGATCGCGCTCCCCCAGCAAATTGTCGGCGCCACGTAGCGCCGGATCC
GGAGGCGGCAGCACCCTGAAGCAGCGCAAGACCACCACCAGCACCACAGC
GGCCCGGAGCCGTGCACCCGGCGGAGCCGGAACTGGTGGCATGTGGCGTT
TCTACACGGACGACTCGCCCGGTATCAAAGTTGGTCCCGTACCCGTGCTG
GTCATGTCGCTGCTGTTCATCGCTTCCGTCTTCATGCTGCACATTTGGGG
CAAATACAATCGTTCTGCAAGCTTTCTAGACC

BO17769.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-09 18:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG10130-PA 303 Sec61beta-RA 1..300 17..316 1475 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-RA 792 CG10130-RA 130..429 17..316 1485 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:01:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14618958..14619170 19..231 1065 100 Plus
2R 25286936 2R 14619234..14619318 232..316 410 98.8 Plus
Blast to na_te.dros performed on 2015-02-12 11:01:15 has no hits.

BO17769.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:12:49 Download gff for BO17769.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10130-PA 1..303 17..320 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 21:34:13 Download gff for BO17769.5prime
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..434 17..322 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:40:43 Download gff for BO17769.5prime
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..434 17..322 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:40:43 Download gff for BO17769.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 14618949..14619170 9..231 98 -> Plus
2R 14619234..14619323 232..322 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 21:34:13 Download gff for BO17769.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10506454..10506675 9..231 98 -> Plus
arm_2R 10506739..10506828 232..322 96   Plus

BO17769.complete Sequence

334 bp assembled on 2007-10-17

GenBank Submission: FJ634208

> BO17769.complete
GAAGTTATCAGTCGACATGCCCGCTCCAGCCAGTTCAACGTCCGTGGGCA
GCGGATCGCGCTCCCCCAGCAAATTGTCGGCGCCACGTAGCGCCGGATCC
GGAGGCGGCAGCACCCTGAAGCAGCGCAAGACCACCACCAGCACCACAGC
GGCCCGGAGCCGTGCACCCGGCGGAGCCGGAACTGGTGGCATGTGGCGTT
TCTACACGGACGACTCGCCCGGTATCAAAGTTGGTCCCGTACCCGTGCTG
GTCATGTCGCTGCTGTTCATCGCTTCCGTCTTCATGCTGCACATTTGGGG
CAAATACAATCGTTCTGCAAGCTTTCTAGACCAT

BO17769.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-RA 303 CG10130-PA 1..300 17..316 1485 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-RA 792 CG10130-RA 130..429 17..316 1485 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14618958..14619170 19..231 1065 100 Plus
2R 25286936 2R 14619234..14619318 232..316 410 98.8 Plus
Blast to na_te.dros performed on 2014-11-27 11:03:44 has no hits.

BO17769.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:03:35 Download gff for BO17769.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 1..303 17..320 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:17:21 Download gff for BO17769.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 174..478 17..322 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:10:02 Download gff for BO17769.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..429 17..318 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:30:35 Download gff for BO17769.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 174..473 17..318 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:37:52 Download gff for BO17769.complete
Subject Subject Range Query Range Percent Splice Strand
Sec61beta-RA 130..429 17..318 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:37:52 Download gff for BO17769.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14618957..14619170 17..231 99 -> Plus
2R 14619234..14619318 232..318 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:10:02 Download gff for BO17769.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10506462..10506675 17..231 99 -> Plus
arm_2R 10506739..10506823 232..318 96   Plus

BO17769.pep Sequence

Translation from 16 to 334

> BO17769.pep
MPAPASSTSVGSGSRSPSKLSAPRSAGSGGGSTLKQRKTTTSTTAARSRA
PGGAGTGGMWRFYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYNRS
ASFLDH

BO17769.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Sec61beta-PA 100 CG10130-PA 1..100 1..100 514 100 Plus