Clone BO17773 Report

Search the DGRC for BO17773

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:177
Well:73
Vector:pDNR-Dual
Associated Gene/Transcriptcrok-RB
Protein status:BO17773.pep: validated full length
Sequenced Size:289

Clone Sequence Records

BO17773.3prime Sequence

287 bp (287 high quality bases) assembled on 2006-10-13

> BO17773.3prime
ATGGTCTAGAAAGCTTGCTTGCCGCAGAAGATGAGCCACAATCACCGAGA
GCAGTGTGCCAGTTAGGACGCCCATCAGTCCTAGCCTATGGATGCCCGCC
GAGTTGCAGCCGTCCTTGCTGTTGCACGTGCAGAACTCCATGAAGATGTT
GTAGCTGCCAGTGCGCATCAGGCAGAAGCGTTCGTCGCCCTCGATGCCCG
GCTCGCCCATGTAGGCGCAGCTGCGAAAGTAGCGCCATTCACCGTGCACC
TTCTGCCGGATCTTGCGACACATGTCGACTGATAACT

BO17773.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG17218-PA 456 CG17218-RA 199..453 273..19 1275 100 Minus
CG17218-PB 258 CG17218-RB 1..255 273..19 1275 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 10:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
crok-RA 1033 CG17218-RA 288..542 273..19 1275 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12173346..12173600 273..19 1275 100 Minus
Blast to na_te.dros performed on 2015-02-06 10:41:39 has no hits.

BO17773.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:12:53 Download gff for BO17773.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17218-PB 1..258 18..273 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:44:17 Download gff for BO17773.3prime
Subject Subject Range Query Range Percent Splice Strand
crok-RA 283..542 19..277 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:28:24 Download gff for BO17773.3prime
Subject Subject Range Query Range Percent Splice Strand
crok-RA 283..542 19..277 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:28:24 Download gff for BO17773.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 12173341..12173600 19..277 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:44:17 Download gff for BO17773.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12173341..12173600 19..277 99   Minus

BO17773.5prime Sequence

287 bp (287 high quality bases) assembled on 2006-10-13

> BO17773.5prime
GAAGTTATCAGTCGACATGTGTCGCAAGATCCGGCAGAAGGTGCACGGTG
AATGGCGCTACTTTCGCAGCTGCGCCTACATGGGCGAGCCGGGCATCGAG
GGCGACGAACGCTTCTGCCTGATGCGCACTGGCAGCTACAACATCTTCAT
GGAGTTCTGCACGTGCAACAGCAAGGACGGCTGCAACTCGGCGGGCATCC
ATAGGCTAGGACTGATGGGCGTCCTAACTGGCACACTGCTCTCGGTGATT
GTGGCTCATCTTCTGCGGCAAGCAAGCTTTCTAGACC

BO17773.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:17:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG17218-PA 456 CG17218-RA 199..453 17..271 1275 100 Plus
CG17218-PB 258 CG17218-RB 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 18:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
crok-RA 1033 CG17218-RA 288..542 17..271 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 18:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12173346..12173600 17..271 1275 100 Plus
Blast to na_te.dros performed on 2015-02-02 18:55:05 has no hits.

BO17773.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:12:54 Download gff for BO17773.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17218-PB 1..258 17..272 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 15:44:31 Download gff for BO17773.5prime
Subject Subject Range Query Range Percent Splice Strand
crok-RA 283..542 13..271 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 19:18:26 Download gff for BO17773.5prime
Subject Subject Range Query Range Percent Splice Strand
crok-RA 283..542 13..271 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 19:18:26 Download gff for BO17773.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 12173341..12173600 13..271 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 15:44:31 Download gff for BO17773.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12173341..12173600 13..271 99   Plus

BO17773.complete Sequence

289 bp assembled on 2006-10-11

GenBank Submission: FJ634210

> BO17773.complete
GAAGTTATCAGTCGACATGTGTCGCAAGATCCGGCAGAAGGTGCACGGTG
AATGGCGCTACTTTCGCAGCTGCGCCTACATGGGCGAGCCGGGCATCGAG
GGCGACGAACGCTTCTGCCTGATGCGCACTGGCAGCTACAACATCTTCAT
GGAGTTCTGCACGTGCAACAGCAAGGACGGCTGCAACTCGGCGGGCATCC
ATAGGCTAGGACTGATGGGCGTCCTAACTGGCACACTGCTCTCGGTGATT
GTGGCTCATCTTCTGCGGCAAGCAAGCTTTCTAGACCAT

BO17773.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
crok-RA 456 CG17218-PA 199..453 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
crok-RA 1033 CG17218-RA 288..542 17..271 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12173346..12173600 17..271 1275 100 Plus
Blast to na_te.dros performed on 2014-11-27 23:39:49 has no hits.

BO17773.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:55:14 Download gff for BO17773.complete
Subject Subject Range Query Range Percent Splice Strand
CG17218-RA 194..456 13..272 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:27:34 Download gff for BO17773.complete
Subject Subject Range Query Range Percent Splice Strand
CG17218-RA 280..539 13..271 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:34:52 Download gff for BO17773.complete
Subject Subject Range Query Range Percent Splice Strand
crok-RA 288..542 17..273 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:55:14 Download gff for BO17773.complete
Subject Subject Range Query Range Percent Splice Strand
CG17218-RA 280..539 13..271 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:05:41 Download gff for BO17773.complete
Subject Subject Range Query Range Percent Splice Strand
crok-RA 288..542 17..273 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:05:41 Download gff for BO17773.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12173346..12173600 17..273 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:34:52 Download gff for BO17773.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12173346..12173600 17..273 99   Plus

BO17773.pep Sequence

Translation from 16 to 289

> BO17773.pep
MCRKIRQKVHGEWRYFRSCAYMGEPGIEGDERFCLMRTGSYNIFMEFCTC
NSKDGCNSAGIHRLGLMGVLTGTLLSVIVAHLLRQASFLDH

BO17773.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
crok-PA 151 CG17218-PA 67..151 1..85 466 100 Plus