Clone BO17810 Report

Search the DGRC for BO17810

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:178
Well:10
Vector:pDNR-Dual
Associated Gene/Transcriptctp-RA
Protein status:BO17810.pep: validated full length
Sequenced Size:301

Clone Sequence Records

BO17810.5prime Sequence

299 bp (299 high quality bases) assembled on 2006-10-13

> BO17810.5prime
GAAGTTATCAGTCGACATGTCTGATCGCAAGGCCGTGATTAAAAATGCCG
ACATGAGCGAGGAGATGCAGCAGGATGCCGTCGATTGTGCGACACAGGCC
CTCGAGAAGTACAACATTGAAAAGGACATTGCGGCCTACATCAAGAAGGA
GTTCGACAAAAAATACAATCCCACATGGCATTGCATTGTCGGTCGCAACT
TTGGATCGTATGTCACACACGAGACGCGCCACTTTATTTACTTCTATTTG
GGCCAGGTGGCTATTTTACTGTTTAAGAGCGGTGCAAGCTTTCTAGACC

BO17810.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:17:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG6998-PB 270 ctp-RB 1..267 17..283 1335 100 Plus
CG6998-PD 270 ctp-RD 1..267 17..283 1335 100 Plus
CG6998-PA 270 ctp-RA 1..267 17..283 1335 100 Plus
CG6998-PC 270 ctp-RC 1..267 17..283 1335 100 Plus
CG5450-PA 270 Cdlc2-RA 79..218 95..234 250 87.1 Plus
CG5450-PB 270 Cdlc2-RB 79..218 95..234 250 87.1 Plus
CG5450-PA 270 Cdlc2-RA 1..59 17..75 145 89.8 Plus
CG5450-PB 270 Cdlc2-RB 1..59 17..75 145 89.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 17:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
ctp-RE 4061 CG6998-RE 216..482 17..283 1335 100 Plus
ctp-RC 4416 CG6998-RC 571..837 17..283 1335 100 Plus
ctp-RA 1483 CG6998-RA 216..482 17..283 1335 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 17:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4698295..4698455 123..283 805 100 Plus
2L 23513712 2L 1344616..1344882 17..283 720 84.6 Plus
X 23542271 X 4691737..4691845 17..125 545 100 Plus
Blast to na_te.dros performed on 2015-01-30 17:37:45 has no hits.

BO17810.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:13:33 Download gff for BO17810.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6998-PA 1..270 17..287 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 18:48:20 Download gff for BO17810.5prime
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 208..487 9..288 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 20:03:38 Download gff for BO17810.5prime
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 208..487 9..288 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 20:03:38 Download gff for BO17810.5prime
Subject Subject Range Query Range Percent Splice Strand
X 4691729..4691844 9..124 97 -> Plus
X 4698297..4698460 125..288 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 18:48:20 Download gff for BO17810.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4585762..4585877 9..124 97 -> Plus
arm_X 4592330..4592493 125..288 98   Plus

BO17810.3prime Sequence

299 bp (299 high quality bases) assembled on 2006-10-13

> BO17810.3prime
ATGGTCTAGAAAGCTTGCACCGCTCTTAAACAGTAAAATAGCCACCTGGC
CCAAATAGAAGTAAATAAAGTGGCGCGTCTCGTGTGTGACATACGATCCA
AAGTTGCGACCGACAATGCAATGCCATGTGGGATTGTATTTTTTGTCGAA
CTCCTTCTTGATGTAGGCCGCAATGTCCTTTTCAATGTTGTACTTCTCGA
GGGCCTGTGTCGCACAATCGACGGCATCCTGCTGCATCTCCTCGCTCATG
TCGGCATTTTTAATCACGGCCTTGCGATCAGACATGTCGACTGATAACT

BO17810.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:17:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG6998-PB 270 ctp-RB 1..267 285..19 1335 100 Minus
CG6998-PD 270 ctp-RD 1..267 285..19 1335 100 Minus
CG6998-PA 270 ctp-RA 1..267 285..19 1335 100 Minus
CG6998-PC 270 ctp-RC 1..267 285..19 1335 100 Minus
CG5450-PA 270 Cdlc2-RA 79..218 207..68 250 87.1 Minus
CG5450-PB 270 Cdlc2-RB 79..218 207..68 250 87.1 Minus
CG5450-PA 270 Cdlc2-RA 1..59 285..227 145 89.8 Minus
CG5450-PB 270 Cdlc2-RB 1..59 285..227 145 89.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:53:22
Subject Length Description Subject Range Query Range Score Percent Strand
ctp-RE 4061 CG6998-RE 216..482 285..19 1335 100 Minus
ctp-RC 4416 CG6998-RC 571..837 285..19 1335 100 Minus
ctp-RA 1483 CG6998-RA 216..482 285..19 1335 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4698295..4698455 179..19 805 100 Minus
2L 23513712 2L 1344616..1344882 285..19 720 84.6 Minus
X 23542271 X 4691737..4691845 285..177 545 100 Minus
Blast to na_te.dros performed on 2015-02-10 20:53:19 has no hits.

BO17810.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:13:32 Download gff for BO17810.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6998-PA 1..270 15..285 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 08:08:17 Download gff for BO17810.3prime
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 208..487 14..293 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:33:36 Download gff for BO17810.3prime
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 208..487 14..293 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:33:36 Download gff for BO17810.3prime
Subject Subject Range Query Range Percent Splice Strand
X 4691729..4691844 178..293 97 -> Minus
X 4698297..4698460 14..177 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 08:08:17 Download gff for BO17810.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4585762..4585877 178..293 97 -> Minus
arm_X 4592330..4592493 14..177 98   Minus

BO17810.complete Sequence

301 bp assembled on 2006-10-11

GenBank Submission: FJ634225

> BO17810.complete
GAAGTTATCAGTCGACATGTCTGATCGCAAGGCCGTGATTAAAAATGCCG
ACATGAGCGAGGAGATGCAGCAGGATGCCGTCGATTGTGCGACACAGGCC
CTCGAGAAGTACAACATTGAAAAGGACATTGCGGCCTACATCAAGAAGGA
GTTCGACAAAAAATACAATCCCACATGGCATTGCATTGTCGGTCGCAACT
TTGGATCGTATGTCACACACGAGACGCGCCACTTTATTTACTTCTATTTG
GGCCAGGTGGCTATTTTACTGTTTAAGAGCGGTGCAAGCTTTCTAGACCA
T

BO17810.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
ctp-RE 270 CG6998-PE 1..267 17..283 1335 100 Plus
ctp-RC 270 CG6998-PC 1..267 17..283 1335 100 Plus
ctp-RA 270 CG6998-PA 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
ctp-RE 4061 CG6998-RE 216..482 17..283 1335 100 Plus
ctp-RC 4416 CG6998-RC 571..837 17..283 1335 100 Plus
ctp-RA 1483 CG6998-RA 216..482 17..283 1335 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4698295..4698455 123..283 805 100 Plus
2L 23513712 2L 1344616..1344882 17..283 720 84.6 Plus
X 23542271 X 4691737..4691845 17..125 545 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:40:02 has no hits.

BO17810.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:22:44 Download gff for BO17810.complete
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 1..270 17..287 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:02:15 Download gff for BO17810.complete
Subject Subject Range Query Range Percent Splice Strand
ctp-RB 321..600 9..288 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:50:11 Download gff for BO17810.complete
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 216..482 17..285 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:22:44 Download gff for BO17810.complete
Subject Subject Range Query Range Percent Splice Strand
ctp-RB 321..600 9..288 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:51:12 Download gff for BO17810.complete
Subject Subject Range Query Range Percent Splice Strand
ctp-RA 216..482 17..285 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:51:12 Download gff for BO17810.complete
Subject Subject Range Query Range Percent Splice Strand
X 4698297..4698455 125..285 98   Plus
X 4691737..4691844 17..124 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:50:11 Download gff for BO17810.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4585770..4585877 17..124 100 -> Plus
arm_X 4592330..4592488 125..285 98   Plus

BO17810.pep Sequence

Translation from 16 to 301

> BO17810.pep
MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKY
NPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSGASFLDH

BO17810.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
ctp-PE 89 CG6998-PE 1..89 1..89 473 100 Plus
ctp-PC 89 CG6998-PC 1..89 1..89 473 100 Plus
ctp-PA 89 CG6998-PA 1..89 1..89 473 100 Plus
ctp-PB 89 CG6998-PB 1..89 1..89 473 100 Plus
Cdlc2-PC 89 CG5450-PC 1..89 1..89 469 98.9 Plus