Clone BO17889 Report

Search the DGRC for BO17889

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:178
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCG13053-RA
Protein status:BO17889.pep:
Sequenced Size:307

Clone Sequence Records

BO17889.3prime Sequence

305 bp (305 high quality bases) assembled on 2006-10-13

> BO17889.3prime
ATGGTCTAGAAAGCTTGCGAGCAGGAACGACGATAGCGACAGGGCGCCGA
TTCCGAGATCGAGGGCACCATAGCGATTGGCATACGGATAGGGGTAGCCG
TACGGACCCGGGCTGTTGTGGTAGTTGTTGTAGTAGCCACCAGCCGGGTA
CCGTCCTCCGTAGTAGTAGGATTCTGGCTGGGGGCCCAGGTAAGGCTGCT
GGTAGCTGACACCGAAGGAGACCAGCGGCTTGGCCTTGATGCAGGTGGTG
GCCACCACCAGGAGCACTGCTAACCAGAGATAATTGCGCATGTCGACTGA
TAACT

BO17889.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-PA 276 CG13053-RA 1..273 291..19 1365 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 06:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-RB 620 CG13053-RB 297..569 291..19 1365 100 Minus
CG13053-RA 358 CG13053-RA 35..307 291..19 1365 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 06:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16259088..16259343 19..274 1280 100 Plus
Blast to na_te.dros performed on 2015-02-03 06:31:06 has no hits.

BO17889.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:14:50 Download gff for BO17889.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13053-PA 1..276 16..291 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:28:25 Download gff for BO17889.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 29..307 19..299 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:37:07 Download gff for BO17889.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 29..307 19..299 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:37:07 Download gff for BO17889.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 16259088..16259342 19..273 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:28:25 Download gff for BO17889.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16252188..16252442 19..273 100 <- Plus

BO17889.5prime Sequence

305 bp (305 high quality bases) assembled on 2006-10-13

> BO17889.5prime
GAAGTTATCAGTCGACATGCGCAATTATCTCTGGTTAGCAGTGCTCCTGG
TGGTGGCCACCACCTGCATCAAGGCCAAGCCGCTGGTCTCCTTCGGTGTC
AGCTACCAGCAGCCTTACCTGGGCCCCCAGCCAGAATCCTACTACTACGG
AGGACGGTACCCGGCTGGTGGCTACTACAACAACTACCACAACAGCCCGG
GTCCGTACGGCTACCCCTATCCGTATGCCAATCGCTATGGTGCCCTCGAT
CTCGGAATCGGCGCCCTGTCGCTATCGTCGTTCCTGCTCGCAAGCTTTCT
AGACC

BO17889.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-PA 276 CG13053-RA 1..273 17..289 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 17:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-RB 620 CG13053-RB 297..569 17..289 1365 100 Plus
CG13053-RA 358 CG13053-RA 35..307 17..289 1365 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 17:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16259088..16259343 289..34 1280 100 Minus
Blast to na_te.dros performed on 2015-01-30 17:38:21 has no hits.

BO17889.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:14:51 Download gff for BO17889.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13053-PA 1..276 17..292 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 18:48:28 Download gff for BO17889.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 29..307 9..289 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 20:03:45 Download gff for BO17889.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 29..307 9..289 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 20:03:45 Download gff for BO17889.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 16259088..16259342 35..289 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 18:48:28 Download gff for BO17889.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16252188..16252442 35..289 100 <- Minus

BO17889.complete Sequence

307 bp assembled on 2006-10-11

GenBank Submission: FJ634248

> BO17889.complete
GAAGTTATCAGTCGACATGCGCAATTATCTCTGGTTAGCAGTGCTCCTGG
TGGTGGCCACCACCTGCATCAAGGCCAAGCCGCTGGTCTCCTTCGGTGTC
AGCTACCAGCAGCCTTACCTGGGCCCCCAGCCAGAATCCTACTACTACGG
AGGACGGTACCCGGCTGGTGGCTACTACAACAACTACCACAACAGCCCGG
GTCCGTACGGCTACCCCTATCCGTATGCCAATCGCTATGGTGCCCTCGAT
CTCGGAATCGGCGCCCTGTCGCTATCGTCGTTCCTGCTCGCAAGCTTTCT
AGACCAT

BO17889.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:16:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-RB 276 CG13053-PB 1..273 17..289 1365 100 Plus
CG13053-RA 276 CG13053-PA 1..273 17..289 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:16:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-RB 620 CG13053-RB 297..569 17..289 1365 100 Plus
CG13053-RA 358 CG13053-RA 35..307 17..289 1365 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16259088..16259343 289..34 1280 100 Minus
Blast to na_te.dros performed on 2014-11-28 01:16:44 has no hits.

BO17889.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:54:01 Download gff for BO17889.complete
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 1..276 17..292 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:26:13 Download gff for BO17889.complete
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 29..307 9..289 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:44:50 Download gff for BO17889.complete
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 35..307 17..291 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:54:01 Download gff for BO17889.complete
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 29..307 9..289 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:49:41 Download gff for BO17889.complete
Subject Subject Range Query Range Percent Splice Strand
CG13053-RA 35..307 17..291 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:49:41 Download gff for BO17889.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16259085..16259342 35..291 99 <- Minus
3L 16259409..16259426 17..34 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:44:50 Download gff for BO17889.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16252185..16252442 35..291 99 <- Minus
arm_3L 16252509..16252526 17..34 100   Minus

BO17889.pep Sequence

Translation from 16 to 307

> BO17889.pep
MRNYLWLAVLLVVATTCIKAKPLVSFGVSYQQPYLGPQPESYYYGGRYPA
GGYYNNYHNSPGPYGYPYPYANRYGALDLGIGALSLSSFLLASFLDH

BO17889.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG13053-PB 91 CG13053-PB 1..91 1..91 502 100 Plus
CG13053-PA 91 CG13053-PA 1..91 1..91 502 100 Plus