Clone BO18010 Report

Search the DGRC for BO18010

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:180
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG5011-RA
Protein status:BO18010.pep: validated full length
Sequenced Size:274

Clone Sequence Records

BO18010.3prime Sequence

272 bp (272 high quality bases) assembled on 2006-10-13

> BO18010.3prime
ATGGTCTAGAAAGCTTGCTCGCGGATGCATTGGAGGTCCTGGGGCCACGT
ATCCTGGACCATATGGATACGGACCATGCGGCGGCGGAGGATTGTAGCCG
GAGCTGTTTCCGTGAGGAGGTTCGTGGTAAATCGGATGCACTGGCGTGTG
GAACGGGGGCTGTGGTTCATGGTGCGGAGGTCCATGGTGCGGTGGTCCGT
GGGGCGGTGGCCCATGAGGCGGCGGGTTGTGGTGGTGGTGCGGTGGTGGA
GGAGGCATGTCGACTGATAACT

BO18010.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5011-PA 243 CG5011-RA 1..240 258..19 1200 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 06:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG5011-RB 550 CG5011-RB 190..429 258..19 1200 100 Minus
CG5011-RA 443 CG5011-RA 83..322 258..19 1200 100 Minus
CG43349-RB 459 CG43349-RB 141..193 222..170 190 90.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 06:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1200860..1201099 258..19 1200 100 Minus
2L 23513712 2L 1200345..1200397 222..170 190 90.6 Minus
Blast to na_te.dros performed on 2015-02-03 06:33:12 has no hits.

BO18010.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:16:57 Download gff for BO18010.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5011-PA 1..243 15..258 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:28:49 Download gff for BO18010.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 76..326 14..265 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:37:23 Download gff for BO18010.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 76..326 14..265 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:37:23 Download gff for BO18010.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 1200860..1201103 14..258 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:28:49 Download gff for BO18010.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1200860..1201103 14..258 99   Minus

BO18010.5prime Sequence

272 bp (272 high quality bases) assembled on 2006-10-13

> BO18010.5prime
GAAGTTATCAGTCGACATGCCTCCTCCACCACCGCACCACCACCACAACC
CGCCGCCTCATGGGCCACCGCCCCACGGACCACCGCACCATGGACCTCCG
CACCATGAACCACAGCCCCCGTTCCACACGCCAGTGCATCCGATTTACCA
CGAACCTCCTCACGGAAACAGCTCCGGCTACAATCCTCCGCCGCCGCATG
GTCCGTATCCATATGGTCCAGGATACGTGGCCCCAGGACCTCCAATGCAT
CCGCGAGCAAGCTTTCTAGACC

BO18010.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:18:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG5011-PA 243 CG5011-RA 1..240 17..256 1200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 10:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG5011-RB 550 CG5011-RB 190..429 17..256 1200 100 Plus
CG5011-RA 443 CG5011-RA 83..322 17..256 1200 100 Plus
CG43349-RB 459 CG43349-RB 141..193 53..105 190 90.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 10:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1200860..1201099 17..256 1200 100 Plus
2L 23513712 2L 1200345..1200397 53..105 190 90.6 Plus
Blast to na_te.dros performed on 2015-01-31 10:05:52 has no hits.

BO18010.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:16:57 Download gff for BO18010.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5011-PA 1..243 17..260 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 23:32:54 Download gff for BO18010.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 76..326 10..261 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:42:31 Download gff for BO18010.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 76..326 10..261 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 12:42:31 Download gff for BO18010.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 1200860..1201103 17..261 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 23:32:54 Download gff for BO18010.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1200860..1201103 17..261 99   Plus

BO18010.complete Sequence

274 bp assembled on 2006-10-11

GenBank Submission: FJ634279

> BO18010.complete
GAAGTTATCAGTCGACATGCCTCCTCCACCACCGCACCACCACCACAACC
CGCCGCCTCATGGGCCACCGCCCCACGGACCACCGCACCATGGACCTCCG
CACCATGAACCACAGCCCCCGTTCCACACGCCAGTGCATCCGATTTACCA
CGAACCTCCTCACGGAAACAGCTCCGGCTACAATCCTCCGCCGCCGCATG
GTCCGTATCCATATGGTCCAGGATACGTGGCCCCAGGACCTCCAATGCAT
CCGCGAGCAAGCTTTCTAGACCAT

BO18010.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG5011-RB 243 CG5011-PB 1..240 17..256 1200 100 Plus
CG5011-RA 243 CG5011-PA 1..240 17..256 1200 100 Plus
CG43349-RB 213 CG43349-PB 106..158 53..105 190 90.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG5011-RB 550 CG5011-RB 190..429 17..256 1200 100 Plus
CG5011-RA 443 CG5011-RA 83..322 17..256 1200 100 Plus
CG43349-RB 459 CG43349-RB 141..193 53..105 190 90.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1200860..1201099 17..256 1200 100 Plus
2L 23513712 2L 1200345..1200397 53..105 190 90.6 Plus
Blast to na_te.dros performed on 2014-11-28 01:03:49 has no hits.

BO18010.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:57:30 Download gff for BO18010.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 1..243 17..260 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:05 Download gff for BO18010.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 617..867 10..261 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:37:55 Download gff for BO18010.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 83..322 17..258 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:57:30 Download gff for BO18010.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 617..867 10..261 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:43:35 Download gff for BO18010.complete
Subject Subject Range Query Range Percent Splice Strand
CG5011-RA 83..322 17..258 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:43:35 Download gff for BO18010.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1200860..1201099 17..258 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:37:55 Download gff for BO18010.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1200860..1201099 17..258 99   Plus

BO18010.pep Sequence

Translation from 16 to 274

> BO18010.pep
MPPPPPHHHHNPPPHGPPPHGPPHHGPPHHEPQPPFHTPVHPIYHEPPHG
NSSGYNPPPPHGPYPYGPGYVAPGPPMHPRASFLDH

BO18010.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG5011-PB 80 CG5011-PB 1..80 1..80 531 100 Plus
CG5011-PA 80 CG5011-PA 1..80 1..80 531 100 Plus
CG43349-PB 70 CG43349-PB 1..70 1..80 242 56.6 Plus
CG43349-PA 70 CG43349-PA 1..70 1..80 242 56.6 Plus
CG13482-PA 102 CG13482-PA 31..96 2..62 151 44.9 Plus