Clone BO18053 Report

Search the DGRC for BO18053

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:180
Well:53
Vector:pDNR-Dual
Associated Gene/TranscriptCG13067-RA
Protein status:BO18053.pep:
Sequenced Size:271

Clone Sequence Records

BO18053.3prime Sequence

269 bp (269 high quality bases) assembled on 2006-10-13

> BO18053.3prime
ATGGTCTAGAAAGCTTGCACGGTAGTAGGCGGCATAGGGGTAGGCGGAGT
AGGCGGACGCATAGGGGTACGTGTAGGCGGAGTAGGCGGCGGCCACTGGA
GCGGTGTATGCCGCGGTGTAGGCAGCCGAGTAAGGAGCAGCTGCCACATA
GGGAGCGGAGTAGGCGCTGTAGGCCAGAGGAGAAGCGAGCACCGCCGGCT
TGGCAGAGACGCAGGCCACGATGGCGAACAGGCACAGAGCGAAGTATTTG
AACATGTCGACTGATAACT

BO18053.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-PA 240 CG13067-RA 1..237 255..19 1185 100 Minus
CG13067-PB 624 CG13067-RB 397..621 243..19 1125 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-RA 564 CG13067-RA 57..295 257..19 1195 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16271425..16271649 243..19 1125 100 Minus
Blast to na_te.dros performed on 2015-02-11 17:27:07 has no hits.

BO18053.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:17:37 Download gff for BO18053.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13067-PA 1..240 15..255 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:21:44 Download gff for BO18053.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 51..299 14..263 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:20:13 Download gff for BO18053.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 51..299 14..263 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:20:13 Download gff for BO18053.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 16271425..16271653 14..243 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:21:44 Download gff for BO18053.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16264525..16264753 14..243 99   Minus

BO18053.5prime Sequence

269 bp (269 high quality bases) assembled on 2006-10-13

> BO18053.5prime
GAAGTTATCAGTCGACATGTTCAAATACTTCGCTCTGTGCCTGTTCGCCA
TCGTGGCCTGCGTCTCTGCCAAGCCGGCGGTGCTCGCTTCTCCTCTGGCC
TACAGCGCCTACTCCGCTCCCTATGTGGCAGCTGCTCCTTACTCGGCTGC
CTACACCGCGGCATACACCGCTCCAGTGGCCGCCGCCTACTCCGCCTACA
CGTACCCCTATGCGTCCGCCTACTCCGCCTACCCCTATGCCGCCTACTAC
CGTGCAAGCTTTCTAGACC

BO18053.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-PA 240 CG13067-RA 1..237 17..253 1185 100 Plus
CG13067-PB 624 CG13067-RB 397..621 29..253 1125 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 10:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-RA 564 CG13067-RA 57..295 15..253 1195 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16271425..16271649 29..253 1125 100 Plus
Blast to na_te.dros performed on 2015-02-06 10:13:58 has no hits.

BO18053.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:17:37 Download gff for BO18053.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13067-PA 1..240 17..257 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:39:18 Download gff for BO18053.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 51..299 9..258 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:24:46 Download gff for BO18053.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 51..299 9..258 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:24:46 Download gff for BO18053.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 16271425..16271653 29..258 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:39:18 Download gff for BO18053.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16264525..16264753 29..258 99   Plus

BO18053.complete Sequence

271 bp assembled on 2006-10-11

GenBank Submission: FJ634299

> BO18053.complete
GAAGTTATCAGTCGACATGTTCAAATACTTCGCTCTGTGCCTGTTCGCCA
TCGTGGCCTGCGTCTCTGCCAAGCCGGCGGTGCTCGCTTCTCCTCTGGCC
TACAGCGCCTACTCCGCTCCCTATGTGGCAGCTGCTCCTTACTCGGCTGC
CTACACCGCGGCATACACCGCTCCAGTGGCCGCCGCCTACTCCGCCTACA
CGTACCCCTATGCGTCCGCCTACTCCGCCTACCCCTATGCCGCCTACTAC
CGTGCAAGCTTTCTAGACCAT

BO18053.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-RA 240 CG13067-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-RA 564 CG13067-RA 57..295 15..253 1195 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16271425..16271649 29..253 1125 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:23:02 has no hits.

BO18053.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:46:09 Download gff for BO18053.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 1..240 17..257 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:04:30 Download gff for BO18053.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 24..272 9..258 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:00:18 Download gff for BO18053.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 64..295 22..255 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:46:09 Download gff for BO18053.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 24..272 9..258 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:40:03 Download gff for BO18053.complete
Subject Subject Range Query Range Percent Splice Strand
CG13067-RA 64..295 22..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:40:03 Download gff for BO18053.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16271425..16271649 29..255 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:00:18 Download gff for BO18053.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16264525..16264749 29..255 99   Plus

BO18053.pep Sequence

Translation from 16 to 271

> BO18053.pep
MFKYFALCLFAIVACVSAKPAVLASPLAYSAYSAPYVAAAPYSAAYTAAY
TAPVAAAYSAYTYPYASAYSAYPYAAYYRASFLDH

BO18053.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13067-PA 79 CG13067-PA 1..79 1..79 408 100 Plus
CG13674-PB 137 CG13674-PB 2..101 3..80 177 47.5 Plus
CG13674-PA 137 CG13674-PA 2..101 3..80 177 47.5 Plus
CG13051-PA 83 CG13051-PA 1..75 1..77 176 56 Plus
CG13069-PA 97 CG13069-PA 1..76 1..76 175 55 Plus