Clone BO18262 Report

Search the DGRC for BO18262

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:182
Well:62
Vector:pDNR-Dual
Associated Gene/Transcriptbcn92-RA
Protein status:BO18262.pep: validated full length
Sequenced Size:310

Clone Sequence Records

BO18262.3prime Sequence

308 bp (308 high quality bases) assembled on 2006-10-13

> BO18262.3prime
ATGGTCTAGAAAGCTTGCGTCGTCCGAGGGCTTCAGGGTCTTCTTGTTCT
CTATAACCAGTTTGTCAGCGGAATACAGGTGGCCGATGATTACCTGGCGA
CGTATCAGCTCCAGATTCTGTTGGCCCTCGGCCATTTGGCGATCGATCTC
CGCGAAGTCCCTGGTGCTCCTGTTGGCGCGGAATGTGTCGCGTATTTTTC
GGGCAGCGTACATTCTGAAGTTGTACGAGGGCAGCTTCTCCGATTCGCGC
AGGAGATTCCTGTATAACGTGATCGCCTGGCGACGGGTCGACATGTCGAC
TGATAACT

BO18262.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG3717-PA 279 bcn92-RA 1..276 294..19 1380 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
bcn92-RA 748 CG3717-RA 167..442 294..19 1380 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:07:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2149219..2149346 92..219 640 100 Plus
X 23542271 X 2149402..2149481 215..294 400 100 Plus
X 23542271 X 2148769..2148846 19..96 390 100 Plus
Blast to na_te.dros performed on 2015-02-12 11:07:30 has no hits.

BO18262.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:20:37 Download gff for BO18262.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3717-PA 1..279 15..294 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:44:34 Download gff for BO18262.3prime
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 163..446 14..302 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:24:09 Download gff for BO18262.3prime
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 163..446 14..302 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:24:09 Download gff for BO18262.3prime
Subject Subject Range Query Range Percent Splice Strand
X 2148765..2148843 14..93 97 <- Plus
X 2149221..2149341 94..214 100 <- Plus
X 2149402..2149485 215..302 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:44:34 Download gff for BO18262.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 2042798..2042876 14..93 97 <- Plus
arm_X 2043254..2043374 94..214 100 <- Plus
arm_X 2043435..2043518 215..302 95   Plus

BO18262.5prime Sequence

308 bp (308 high quality bases) assembled on 2006-10-13

> BO18262.5prime
GAAGTTATCAGTCGACATGTCGACCCGTCGCCAGGCGATCACGTTATACA
GGAATCTCCTGCGCGAATCGGAGAAGCTGCCCTCGTACAACTTCAGAATG
TACGCTGCCCGAAAAATACGCGACACATTCCGCGCCAACAGGAGCACCAG
GGACTTCGCGGAGATCGATCGCCAAATGGCCGAGGGCCAACAGAATCTGG
AGCTGATACGTCGCCAGGTAATCATCGGCCACCTGTATTCCGCTGACAAA
CTGGTTATAGAGAACAAGAAGACCCTGAAGCCCTCGGACGACGCAAGCTT
TCTAGACC

BO18262.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG3717-PA 279 bcn92-RA 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
bcn92-RA 748 CG3717-RA 167..442 17..292 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2149219..2149346 219..92 640 100 Minus
X 23542271 X 2149402..2149481 96..17 400 100 Minus
X 23542271 X 2148769..2148846 292..215 390 100 Minus
Blast to na_te.dros performed on 2015-02-12 11:07:36 has no hits.

BO18262.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:20:38 Download gff for BO18262.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3717-PA 1..279 17..296 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:44:36 Download gff for BO18262.5prime
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 163..446 9..297 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:24:22 Download gff for BO18262.5prime
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 163..446 9..297 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:24:22 Download gff for BO18262.5prime
Subject Subject Range Query Range Percent Splice Strand
X 2149221..2149341 97..217 100 <- Minus
X 2149402..2149485 9..96 95   Minus
X 2148765..2148843 218..297 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:44:36 Download gff for BO18262.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 2042798..2042876 218..297 97 <- Minus
arm_X 2043254..2043374 97..217 100 <- Minus
arm_X 2043435..2043518 9..96 95   Minus

BO18262.complete Sequence

310 bp assembled on 2006-10-11

GenBank Submission: FJ634364

> BO18262.complete
GAAGTTATCAGTCGACATGTCGACCCGTCGCCAGGCGATCACGTTATACA
GGAATCTCCTGCGCGAATCGGAGAAGCTGCCCTCGTACAACTTCAGAATG
TACGCTGCCCGAAAAATACGCGACACATTCCGCGCCAACAGGAGCACCAG
GGACTTCGCGGAGATCGATCGCCAAATGGCCGAGGGCCAACAGAATCTGG
AGCTGATACGTCGCCAGGTAATCATCGGCCACCTGTATTCCGCTGACAAA
CTGGTTATAGAGAACAAGAAGACCCTGAAGCCCTCGGACGACGCAAGCTT
TCTAGACCAT

BO18262.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
bcn92-RA 279 CG3717-PA 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:43:26
Subject Length Description Subject Range Query Range Score Percent Strand
bcn92-RA 748 CG3717-RA 167..442 17..292 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2149219..2149346 219..92 640 100 Minus
X 23542271 X 2149402..2149481 96..17 400 100 Minus
X 23542271 X 2148769..2148846 292..215 390 100 Minus
Blast to na_te.dros performed on 2014-11-26 15:43:23 has no hits.

BO18262.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:54:05 Download gff for BO18262.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 1..279 17..296 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:26:18 Download gff for BO18262.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 116..399 9..297 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:42:52 Download gff for BO18262.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 167..442 17..294 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:54:05 Download gff for BO18262.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 116..399 9..297 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:02:14 Download gff for BO18262.complete
Subject Subject Range Query Range Percent Splice Strand
bcn92-RA 167..442 17..294 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:02:14 Download gff for BO18262.complete
Subject Subject Range Query Range Percent Splice Strand
X 2149221..2149341 97..217 100 <- Minus
X 2149402..2149481 17..96 100   Minus
X 2148767..2148843 218..294 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:42:52 Download gff for BO18262.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2043435..2043514 17..96 100   Minus
arm_X 2043254..2043374 97..217 100 <- Minus
arm_X 2042800..2042876 218..294 97 <- Minus

BO18262.pep Sequence

Translation from 16 to 310

> BO18262.pep
MSTRRQAITLYRNLLRESEKLPSYNFRMYAARKIRDTFRANRSTRDFAEI
DRQMAEGQQNLELIRRQVIIGHLYSADKLVIENKKTLKPSDDASFLDH

BO18262.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:38:11
Subject Length Description Subject Range Query Range Score Percent Strand
bcn92-PA 92 CG3717-PA 1..92 1..92 460 100 Plus