Clone BO18276 Report

Search the DGRC for BO18276

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:182
Well:76
Vector:pDNR-Dual
Associated Gene/TranscriptCG13041-RA
Protein status:BO18276.pep:
Sequenced Size:406

Clone Sequence Records

BO18276.3prime Sequence

404 bp (404 high quality bases) assembled on 2006-10-13

> BO18276.3prime
ATGGTCTAGAAAGCTTGCGTGGTGCAGGGTGTAGGCCAGGGGAGCGGAGT
GCACCACCGACTTGACGAGGGGAGCTGAGTGGACCAGAGGCACAGAGTGG
ACGACTGGAGCGGCGTGGACAACGGGCACGGAGTGAACCACTGGAGCAGC
GTGGACGGCAACGGCGGGATGGGAGTAGGTGGTGGTCTTCACGATGGGAG
CAACCACTGGCTGCACCACCGCCTTGCTGTGCACCTGGGTGATGCTCTGG
TGGGAAACCGCCGAGGGAGCAGAGTGCACCACCGATCCAACCTTGGCCAG
AACGGGCTCGTGCACCACATGGTGAGTCTCGATGAGACCAGCACTGGCGG
TGGCGACCAGGAGAGCGATGACAGCAACAAATTTGAACATGTCGACTGAT
AACT

BO18276.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13041-PA 375 CG13041-RA 1..372 390..19 1860 100 Minus
CG13060-PA 396 CG13060-RA 19..296 372..95 1315 98.9 Minus
CG13060-PA 396 CG13060-RA 331..393 81..19 240 95.2 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:07:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG13041-RA 513 CG13041-RA 68..439 390..19 1860 100 Minus
CG13060-RA 539 CG13060-RA 71..473 390..9 1435 91.1 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:07:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16319028..16319387 19..378 1800 100 Plus
3L 28110227 3L 16320004..16320281 372..95 1345 98.9 Minus
3L 28110227 3L 16320316..16320388 81..9 275 91.8 Minus
Blast to na_te.dros performed on 2015-02-12 11:07:53 has no hits.

BO18276.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:20:49 Download gff for BO18276.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13041-PA 1..375 15..390 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:44:40 Download gff for BO18276.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 63..443 14..395 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:24:50 Download gff for BO18276.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 63..443 14..395 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:24:50 Download gff for BO18276.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 16319024..16319387 14..378 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:44:40 Download gff for BO18276.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16312124..16312487 14..378 99 <- Plus

BO18276.5prime Sequence

404 bp (404 high quality bases) assembled on 2006-10-13

> BO18276.5prime
GAAGTTATCAGTCGACATGTTCAAATTTGTTGCTGTCATCGCTCTCCTGG
TCGCCACCGCCAGTGCTGGTCTCATCGAGACTCACCATGTGGTGCACGAG
CCCGTTCTGGCCAAGGTTGGATCGGTGGTGCACTCTGCTCCCTCGGCGGT
TTCCCACCAGAGCATCACCCAGGTGCACAGCAAGGCGGTGGTGCAGCCAG
TGGTTGCTCCCATCGTGAAGACCACCACCTACTCCCATCCCGCCGTTGCC
GTCCACGCTGCTCCAGTGGTTCACTCCGTGCCCGTTGTCCACGCCGCTCC
AGTCGTCCACTCTGTGCCTCTGGTCCACTCAGCTCCCCTCGTCAAGTCGG
TGGTGCACTCCGCTCCCCTGGCCTACACCCTGCACCACGCAAGCTTTCTA
GACC

BO18276.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:20:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG13041-PA 375 CG13041-RA 1..372 17..388 1860 100 Plus
CG13060-PA 396 CG13060-RA 19..296 35..312 1315 98.9 Plus
CG13060-PA 396 CG13060-RA 331..393 326..388 240 95.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG13041-RA 513 CG13041-RA 68..439 17..388 1860 100 Plus
CG13060-RA 539 CG13060-RA 71..473 17..398 1435 91.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16319028..16319387 388..29 1800 100 Minus
3L 28110227 3L 16320004..16320281 35..312 1345 98.9 Plus
3L 28110227 3L 16320316..16320388 326..398 275 91.8 Plus
Blast to na_te.dros performed on 2015-02-10 20:57:10 has no hits.

BO18276.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:20:50 Download gff for BO18276.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13041-PA 1..375 17..392 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:23:19 Download gff for BO18276.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 63..443 12..393 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:34:31 Download gff for BO18276.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 63..443 12..393 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:34:31 Download gff for BO18276.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 16319024..16319387 29..393 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:23:19 Download gff for BO18276.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16312124..16312487 29..393 99 <- Minus

BO18276.complete Sequence

406 bp assembled on 2006-10-11

GenBank Submission: FJ634369

> BO18276.complete
GAAGTTATCAGTCGACATGTTCAAATTTGTTGCTGTCATCGCTCTCCTGG
TCGCCACCGCCAGTGCTGGTCTCATCGAGACTCACCATGTGGTGCACGAG
CCCGTTCTGGCCAAGGTTGGATCGGTGGTGCACTCTGCTCCCTCGGCGGT
TTCCCACCAGAGCATCACCCAGGTGCACAGCAAGGCGGTGGTGCAGCCAG
TGGTTGCTCCCATCGTGAAGACCACCACCTACTCCCATCCCGCCGTTGCC
GTCCACGCTGCTCCAGTGGTTCACTCCGTGCCCGTTGTCCACGCCGCTCC
AGTCGTCCACTCTGTGCCTCTGGTCCACTCAGCTCCCCTCGTCAAGTCGG
TGGTGCACTCCGCTCCCCTGGCCTACACCCTGCACCACGCAAGCTTTCTA
GACCAT

BO18276.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13041-RA 375 CG13041-PA 1..372 17..388 1860 100 Plus
CG13060-RA 396 CG13060-PA 1..296 17..312 1375 97.6 Plus
CG13060-RA 396 CG13060-PA 331..393 326..388 270 95.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13041-RA 513 CG13041-RA 68..439 17..388 1860 100 Plus
CG13060-RA 539 CG13060-RA 71..366 17..312 1375 97.6 Plus
CG13060-RA 539 CG13060-RA 401..473 326..398 275 91.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16319028..16319387 388..29 1800 100 Minus
3L 28110227 3L 16320004..16320281 35..312 1345 98.9 Plus
3L 28110227 3L 16320316..16320388 326..398 275 91.8 Plus
Blast to na_te.dros performed on 2014-11-27 08:37:13 has no hits.

BO18276.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:38:12 Download gff for BO18276.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 1..375 17..392 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:00:04 Download gff for BO18276.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 57..437 12..393 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:12:20 Download gff for BO18276.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 73..439 22..390 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:38:12 Download gff for BO18276.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 57..437 12..393 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:23:23 Download gff for BO18276.complete
Subject Subject Range Query Range Percent Splice Strand
CG13041-RA 73..439 22..390 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:23:23 Download gff for BO18276.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16319026..16319391 22..390 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:12:20 Download gff for BO18276.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16312126..16312491 22..390 98   Minus

BO18276.pep Sequence

Translation from 16 to 406

> BO18276.pep
MFKFVAVIALLVATASAGLIETHHVVHEPVLAKVGSVVHSAPSAVSHQSI
TQVHSKAVVQPVVAPIVKTTTYSHPAVAVHAAPVVHSVPVVHAAPVVHSV
PLVHSAPLVKSVVHSAPLAYTLHHASFLDH

BO18276.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG13041-PA 124 CG13041-PA 1..124 1..124 621 100 Plus
CG13060-PA 131 CG13060-PA 1..131 1..124 584 90.8 Plus
CG13044-PA 155 CG13044-PA 1..146 1..125 268 48.4 Plus
CG13040-PB 185 CG13040-PB 1..145 1..125 240 45.9 Plus
CG13040-PA 185 CG13040-PA 1..145 1..125 240 45.9 Plus