Clone BO18324 Report

Search the DGRC for BO18324

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:183
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptLcp65Ab1-RA
Protein status:BO18324.pep: validated full length
Sequenced Size:346

Clone Sequence Records

BO18324.5prime Sequence

344 bp (344 high quality bases) assembled on 2006-10-13

> BO18324.5prime
GAAGTTATCAGTCGACATGAAATTCCTCATCGTCTTCGTCGCCCTCTTCG
CCATGGCAGTGGCCCGCCCCAACCTTGCCGAGATCGTGAGGCAGGTCTCC
GATGTTGAGCCCGAGAAGTGGAGCTCCGACGTGGAGACCAGCGATGGCAC
CAGCATCAAACAGGAGGGTGTCCTCAAGAACGCTGGCACTGACAACGAGG
CCGCTGTCGTCCACGGATCCTTCACCTGGGTGGATGAGAAGACCGGCGAG
AAGTTCACCATCACATACGTGGCTGATGAGAACGGATACCAGCCCCAGGG
CGCCCATCTGCCCGTGGCACCAGTTGCTGCAAGCTTTCTAGACC

BO18324.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG32400-PA 315 Lcp65Ab1-RA 1..312 17..328 1560 100 Plus
CG18773-PA 315 Lcp65Ab2-RA 1..312 17..328 1560 100 Plus
CG10533-PA 303 Lcp65Af-RA 250..287 278..315 165 97.3 Plus
CG18777-PA 309 CG18777-RA 244..293 266..315 150 92 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 17:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ab1-RA 413 CG32400-RA 44..357 15..328 1570 100 Plus
Lcp65Ab2-RA 416 CG18773-RA 47..360 15..328 1570 100 Plus
Cpr65Ax1-RA 389 CG34270-RA 282..353 256..327 225 87.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 17:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6146720..6147033 15..328 1570 100 Plus
3L 28110227 3L 6149591..6149904 15..328 1570 100 Plus
3L 28110227 3L 6147567..6147638 327..256 225 87.5 Minus
3L 28110227 3L 6150438..6150509 327..256 225 87.5 Minus
Blast to na_te.dros performed on 2015-01-30 17:50:14 has no hits.

BO18324.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:21:23 Download gff for BO18324.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18773-PA 1..315 17..332 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 18:50:52 Download gff for BO18324.5prime
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab1-RA 36..361 9..333 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 20:05:35 Download gff for BO18324.5prime
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab2-RA 39..364 9..333 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 20:05:35 Download gff for BO18324.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 6146712..6147037 9..333 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 18:50:52 Download gff for BO18324.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6139812..6140137 9..333 98   Plus

BO18324.complete Sequence

346 bp assembled on 2006-10-11

GenBank Submission: FJ634380

> BO18324.complete
GAAGTTATCAGTCGACATGAAATTCCTCATCGTCTTCGTCGCCCTCTTCG
CCATGGCAGTGGCCCGCCCCAACCTTGCCGAGATCGTGAGGCAGGTCTCC
GATGTTGAGCCCGAGAAGTGGAGCTCCGACGTGGAGACCAGCGATGGCAC
CAGCATCAAACAGGAGGGTGTCCTCAAGAACGCTGGCACTGACAACGAGG
CCGCTGTCGTCCACGGATCCTTCACCTGGGTGGATGAGAAGACCGGCGAG
AAGTTCACCATCACATACGTGGCTGATGAGAACGGATACCAGCCCCAGGG
CGCCCATCTGCCCGTGGCACCAGTTGCTGCAAGCTTTCTAGACCAT

BO18324.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ab1-RA 315 CG32400-PA 1..312 17..328 1560 100 Plus
Lcp65Ab2-RA 315 CG18773-PA 1..312 17..328 1560 100 Plus
Cpr65Ax1-RA 309 CG34270-PA 234..305 256..327 225 87.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ab1-RA 413 CG32400-RA 44..357 15..328 1570 100 Plus
Lcp65Ab2-RA 416 CG18773-RA 47..360 15..328 1570 100 Plus
Cpr65Ax1-RA 389 CG34270-RA 282..353 256..327 225 87.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6146720..6147033 15..328 1570 100 Plus
3L 28110227 3L 6149591..6149904 15..328 1570 100 Plus
3L 28110227 3L 6147567..6147638 327..256 225 87.5 Minus
3L 28110227 3L 6150438..6150509 327..256 225 87.5 Minus
Blast to na_te.dros performed on 2014-11-26 21:37:32 has no hits.

BO18324.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:37:35 Download gff for BO18324.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab1-RA 1..315 17..332 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:10:40 Download gff for BO18324.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab2-RA 42..367 9..333 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:31:50 Download gff for BO18324.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab1-RA 46..357 17..330 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:37:35 Download gff for BO18324.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab2-RA 42..367 9..333 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:06 Download gff for BO18324.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp65Ab2-RA 49..360 17..330 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:38:06 Download gff for BO18324.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6146722..6147033 17..330 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:31:50 Download gff for BO18324.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6139822..6140133 17..330 99   Plus

BO18324.pep Sequence

Translation from 16 to 346

> BO18324.pep
MKFLIVFVALFAMAVARPNLAEIVRQVSDVEPEKWSSDVETSDGTSIKQE
GVLKNAGTDNEAAVVHGSFTWVDEKTGEKFTITYVADENGYQPQGAHLPV
APVAASFLDH

BO18324.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 21:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp65Ab1-PA 104 CG32400-PA 1..104 1..104 533 100 Plus
Lcp65Ab2-PA 104 CG18773-PA 1..104 1..104 533 100 Plus
Cpr65Ax1-PA 102 CG34270-PA 1..102 1..104 301 61.5 Plus
Cpr65Ax2-PB 102 CG18777-PB 1..102 1..104 301 61.5 Plus
Cpr65Ax2-PA 102 CG18777-PA 1..102 1..104 301 61.5 Plus