Clone BO18365 Report

Search the DGRC for BO18365

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:183
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptElongin-B-RA
Protein status:BO18365.pep: validated full length
Sequenced Size:388

Clone Sequence Records

BO18365.3prime Sequence

386 bp (386 high quality bases) assembled on 2006-10-13

> BO18365.3prime
ATGGTCTAGAAAGCTTGCTGCCACCTGCTCCTGTCCGTTCGAGGCCTCTT
GGTTTTTCATGACTTCGGGTAAGTCTGGTGGTGCCGAGTAGGGTGTCATG
TCCAGTGTCTCAAAGTCGCCCACCTCGTTCCTGAATGTCAAGCCCAGCTG
TGCCGGAGCCTGCGCCTTGGCCGTGGACACCGTCACGCCGTAGTCCTGCA
ACGTGCTGTCGTCCTCCATGACATCGTTGTCCTGATTGTATAACCGCTGG
TCCACGGGCTGCACCTTTAGTATGCCCTCAATCATTCGCTTCAGCTCGGC
CACCGTTGTGTTCTCCTTGGCGTCCGTGAAGATGGTGGTCTTTTGCCGCC
TGATCATAAGGAACACGTCCATGTCGACTGATAACT

BO18365.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG4204-PA 357 Elongin-B-RA 1..354 372..19 1770 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 11:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
EloB-RA 1207 CG4204-RA 395..748 372..19 1770 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 11:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20578913..20579059 130..276 735 100 Plus
3R 32079331 3R 20578681..20578794 19..132 570 100 Plus
3R 32079331 3R 20579138..20579233 275..370 480 100 Plus
Blast to na_te.dros performed on 2015-02-08 11:57:30 has no hits.

BO18365.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:21:52 Download gff for BO18365.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4204-PA 1..357 15..372 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:38:26 Download gff for BO18365.3prime
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 387..752 14..381 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:43:25 Download gff for BO18365.3prime
Subject Subject Range Query Range Percent Splice Strand
EloB-RA 387..752 14..381 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:43:25 Download gff for BO18365.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 20578677..20578792 14..130 98 <- Plus
3R 20578914..20579058 131..275 100 <- Plus
3R 20579139..20579242 276..381 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:38:26 Download gff for BO18365.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16404399..16404514 14..130 98 <- Plus
arm_3R 16404636..16404780 131..275 100 <- Plus
arm_3R 16404861..16404964 276..381 95   Plus

BO18365.5prime Sequence

386 bp (386 high quality bases) assembled on 2006-10-13

> BO18365.5prime
GAAGTTATCAGTCGACATGGACGTGTTCCTTATGATCAGGCGGCAAAAGA
CCACCATCTTCACGGACGCCAAGGAGAACACAACGGTGGCCGAGCTGAAG
CGAATGATTGAGGGCATACTAAAGGTGCAGCCCGTGGACCAGCGGTTATA
CAATCAGGACAACGATGTCATGGAGGACGACAGCACGTTGCAGGACTACG
GCGTGACGGTGTCCACGGCCAAGGCGCAGGCTCCGGCACAGCTGGGCTTG
ACATTCAGGAACGAGGTGGGCGACTTTGAGACACTGGACATGACACCCTA
CTCGGCACCACCAGACTTACCCGAAGTCATGAAAAACCAAGAGGCCTCGA
ACGGACAGGAGCAGGTGGCAGCAAGCTTTCTAGACC

BO18365.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG4204-PA 357 Elongin-B-RA 1..354 17..370 1770 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
EloB-RA 1207 CG4204-RA 395..748 17..370 1770 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20578913..20579059 259..113 735 100 Minus
3R 32079331 3R 20578681..20578794 370..257 570 100 Minus
3R 32079331 3R 20579138..20579233 114..19 480 100 Minus
Blast to na_te.dros performed on 2015-02-12 17:46:44 has no hits.

BO18365.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:21:52 Download gff for BO18365.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4204-PA 1..357 17..374 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 02:42:06 Download gff for BO18365.5prime
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 387..752 8..375 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:43:48 Download gff for BO18365.5prime
Subject Subject Range Query Range Percent Splice Strand
EloB-RA 387..752 8..375 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:43:48 Download gff for BO18365.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 20578914..20579058 114..258 100 <- Minus
3R 20579139..20579242 8..113 95   Minus
3R 20578677..20578792 259..375 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 02:42:06 Download gff for BO18365.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16404399..16404514 259..375 98 <- Minus
arm_3R 16404636..16404780 114..258 100 <- Minus
arm_3R 16404861..16404964 8..113 95   Minus

BO18365.complete Sequence

388 bp assembled on 2006-10-11

GenBank Submission: FJ634393

> BO18365.complete
GAAGTTATCAGTCGACATGGACGTGTTCCTTATGATCAGGCGGCAAAAGA
CCACCATCTTCACGGACGCCAAGGAGAACACAACGGTGGCCGAGCTGAAG
CGAATGATTGAGGGCATACTAAAGGTGCAGCCCGTGGACCAGCGGTTATA
CAATCAGGACAACGATGTCATGGAGGACGACAGCACGTTGCAGGACTACG
GCGTGACGGTGTCCACGGCCAAGGCGCAGGCTCCGGCACAGCTGGGCTTG
ACATTCAGGAACGAGGTGGGCGACTTTGAGACACTGGACATGACACCCTA
CTCGGCACCACCAGACTTACCCGAAGTCATGAAAAACCAAGAGGCCTCGA
ACGGACAGGAGCAGGTGGCAGCAAGCTTTCTAGACCAT

BO18365.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
EloB-RA 357 CG4204-PA 1..354 17..370 1770 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
EloB-RA 1207 CG4204-RA 395..748 17..370 1770 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20578913..20579059 259..113 735 100 Minus
3R 32079331 3R 20578681..20578794 370..257 570 100 Minus
3R 32079331 3R 20579138..20579233 114..19 480 100 Minus
Blast to na_te.dros performed on 2014-11-27 23:56:12 has no hits.

BO18365.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:20:58 Download gff for BO18365.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 1..357 17..374 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:39:59 Download gff for BO18365.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 408..773 8..375 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:41:52 Download gff for BO18365.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 395..748 17..372 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:20:59 Download gff for BO18365.complete
Subject Subject Range Query Range Percent Splice Strand
Elongin-B-RA 408..773 8..375 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:11:12 Download gff for BO18365.complete
Subject Subject Range Query Range Percent Splice Strand
EloB-RA 395..748 17..372 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:11:12 Download gff for BO18365.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20578914..20579058 114..258 100 <- Minus
3R 20579139..20579234 17..113 98   Minus
3R 20578679..20578792 259..372 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:41:52 Download gff for BO18365.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16404636..16404780 114..258 100 <- Minus
arm_3R 16404861..16404956 17..113 98   Minus
arm_3R 16404401..16404514 259..372 98 <- Minus

BO18365.pep Sequence

Translation from 16 to 388

> BO18365.pep
MDVFLMIRRQKTTIFTDAKENTTVAELKRMIEGILKVQPVDQRLYNQDND
VMEDDSTLQDYGVTVSTAKAQAPAQLGLTFRNEVGDFETLDMTPYSAPPD
LPEVMKNQEASNGQEQVAASFLDH

BO18365.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
EloB-PA 118 CG4204-PA 1..118 1..118 598 100 Plus