Clone BO18373 Report

Search the DGRC for BO18373

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:183
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptSmG-RA
Protein status:BO18373.pep:
Sequenced Size:262

Clone Sequence Records

BO18373.3prime Sequence

260 bp (260 high quality bases) assembled on 2006-10-13

> BO18373.3prime
ATGGTCTAGAAAGCTTGCGACCCTGTCCAGGGCCTCCACCATGACGATGC
TGTTGCCGCGGATAACCACCATGCCGATGTTGTTCTTCGTGTTGTCCTTG
CACTCCTCCACCGTGTCGTCCAGGACCACGTTCATGAAGGGATCGAAGCC
TCGCAAAATACCGGTCACCGCGCGTCCGCCGTTCAGTTTCAGCATCATGC
GCTTGTCCATGTATTTTTTCACCTCTGGGGGATGGGCCTTCGACATGTCG
ACTGATAACT

BO18373.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG9742-PA 231 CG9742-RA 1..228 246..19 1140 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
SmG-RB 432 CG9742-RB 83..310 246..19 1140 100 Minus
SmG-RA 483 CG9742-RA 83..310 246..19 1140 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 09:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16640091..16640240 65..214 750 100 Plus
X 23542271 X 16639983..16640031 19..67 245 100 Plus
Blast to na_te.dros performed on 2015-02-11 09:09:47 has no hits.

BO18373.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:21:57 Download gff for BO18373.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9742-PA 1..231 18..246 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 17:02:01 Download gff for BO18373.3prime
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 76..314 13..254 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 11:15:53 Download gff for BO18373.3prime
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 76..314 13..254 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 11:15:53 Download gff for BO18373.3prime
Subject Subject Range Query Range Percent Splice Strand
X 16639979..16640030 13..66 94 <- Plus
X 16640093..16640240 67..214 100 <- Plus
X 16640306..16640344 215..254 92   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 17:02:01 Download gff for BO18373.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 16534012..16534063 13..66 94 <- Plus
arm_X 16534126..16534273 67..214 100 <- Plus
arm_X 16534339..16534377 215..254 92   Plus

BO18373.5prime Sequence

260 bp (260 high quality bases) assembled on 2006-10-13

> BO18373.5prime
GAAGTTATCAGTCGACATGTCGAAGGCCCATCCCCCAGAGGTGAAAAAAT
ACATGGACAAGCGCATGATGCTGAAACTGAACGGCGGACGCGCGGTGACC
GGTATTTTGCGAGGCTTCGATCCCTTCATGAACGTGGTCCTGGACGACAC
GGTGGAGGAGTGCAAGGACAACACGAAGAACAACATCGGCATGGTGGTTA
TCCGCGGCAACAGCATCGTCATGGTGGAGGCCCTGGACAGGGTCGCAAGC
TTTCTAGACC

BO18373.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG9742-PA 231 CG9742-RA 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 11:57:47
Subject Length Description Subject Range Query Range Score Percent Strand
SmG-RB 432 CG9742-RB 83..310 17..244 1140 100 Plus
SmG-RA 483 CG9742-RA 83..310 17..244 1140 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 11:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16640091..16640240 198..49 750 100 Minus
X 23542271 X 16639983..16640031 244..196 245 100 Minus
Blast to na_te.dros performed on 2015-02-08 11:57:42 has no hits.

BO18373.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:21:58 Download gff for BO18373.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9742-PA 1..231 17..245 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:38:29 Download gff for BO18373.5prime
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 76..314 9..250 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:43:28 Download gff for BO18373.5prime
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 76..314 9..250 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:43:28 Download gff for BO18373.5prime
Subject Subject Range Query Range Percent Splice Strand
X 16639979..16640030 197..250 94 <- Minus
X 16640093..16640240 49..196 100 <- Minus
X 16640306..16640344 9..48 92   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:38:29 Download gff for BO18373.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 16534012..16534063 197..250 94 <- Minus
arm_X 16534126..16534273 49..196 100 <- Minus
arm_X 16534339..16534377 9..48 92   Minus

BO18373.complete Sequence

262 bp assembled on 2006-10-11

GenBank Submission: FJ634396

> BO18373.complete
GAAGTTATCAGTCGACATGTCGAAGGCCCATCCCCCAGAGGTGAAAAAAT
ACATGGACAAGCGCATGATGCTGAAACTGAACGGCGGACGCGCGGTGACC
GGTATTTTGCGAGGCTTCGATCCCTTCATGAACGTGGTCCTGGACGACAC
GGTGGAGGAGTGCAAGGACAACACGAAGAACAACATCGGCATGGTGGTTA
TCCGCGGCAACAGCATCGTCATGGTGGAGGCCCTGGACAGGGTCGCAAGC
TTTCTAGACCAT

BO18373.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:59:36
Subject Length Description Subject Range Query Range Score Percent Strand
SmG-RB 231 CG9742-PB 1..228 17..244 1140 100 Plus
SmG-RA 231 CG9742-PA 1..228 17..244 1140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:59:37
Subject Length Description Subject Range Query Range Score Percent Strand
SmG-RB 432 CG9742-RB 83..310 17..244 1140 100 Plus
SmG-RA 483 CG9742-RA 83..310 17..244 1140 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16640091..16640240 198..49 750 100 Minus
X 23542271 X 16639983..16640031 244..196 245 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:59:35 has no hits.

BO18373.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:37:24 Download gff for BO18373.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RB 1..231 17..245 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:58:59 Download gff for BO18373.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 70..308 9..250 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:30:43 Download gff for BO18373.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 83..310 17..246 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:37:24 Download gff for BO18373.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 70..308 9..250 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:00:55 Download gff for BO18373.complete
Subject Subject Range Query Range Percent Splice Strand
SmG-RA 83..310 17..246 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:00:55 Download gff for BO18373.complete
Subject Subject Range Query Range Percent Splice Strand
X 16639979..16640030 197..246 96 <- Minus
X 16640093..16640240 49..196 100 <- Minus
X 16640306..16640337 17..48 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:30:43 Download gff for BO18373.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16534012..16534063 197..246 96 <- Minus
arm_X 16534126..16534273 49..196 100 <- Minus
arm_X 16534339..16534370 17..48 100   Minus

BO18373.pep Sequence

Translation from 16 to 262

> BO18373.pep
MSKAHPPEVKKYMDKRMMLKLNGGRAVTGILRGFDPFMNVVLDDTVEECK
DNTKNNIGMVVIRGNSIVMVEALDRVASFLDH

BO18373.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
SmG-PB 76 CG9742-PB 1..76 1..76 391 100 Plus
SmG-PA 76 CG9742-PA 1..76 1..76 391 100 Plus
LSm7-PB 110 CG13277-PB 23..102 8..78 145 36.2 Plus
LSm7-PC 110 CG13277-PC 23..102 8..78 145 36.2 Plus
LSm7-PA 110 CG13277-PA 23..102 8..78 145 36.2 Plus