Clone BO18393 Report

Search the DGRC for BO18393

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:183
Well:93
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO18393.pep: validated full length
Sequenced Size:382

Clone Sequence Records

BO18393.5prime Sequence

380 bp (380 high quality bases) assembled on 2006-10-13

> BO18393.5prime
GAAGTTATCAGTCGACATGCAGCACAAGTCGAGACCAGGAAGACTCTTAG
TCACACGGAAGGAGCATCAGAAAATAGCAGTTGAAAAGTTTAGTTTAAGT
GTAAGAGCAACAACAACAACAATAACAAGAACAAGAACCACATCGACAAC
GACAGGCAGCAGAACTTGGCTTAAATGCGCTCATGTGCAAAAATGCCATT
GTTTTGGATTTGGTCGTAAACAAAGCGGTGAAGTGAAGGCAAAAAATTTC
CTTTTTCCTTTCCACACCCCCCAAGAAGCAAAGAAAAACTTGGAAAGGTT
GGCACATTTTCCACCTCTCCCGGTCGAAGTTGGGGGCGAAAAAAAGAAAA
CGGAAGGCACTGGCGCAAGCTTTCTAGACC

BO18393.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG31246-PA 351 CG31246-RA 1..348 17..364 1740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed on 2015-02-06 10:24:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 10:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17836945..17837292 17..364 1740 100 Plus
Blast to na_te.dros performed on 2015-02-06 10:24:53 has no hits.

BO18393.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:22:13 Download gff for BO18393.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31246-PA 1..351 17..365 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:26:15 Download gff for BO18393.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 17836945..17837292 17..364 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:26:15 Download gff for BO18393.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 17836945..17837292 17..364 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:41:25 Download gff for BO18393.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13662667..13663014 17..364 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:41:25 Download gff for BO18393.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13662667..13663014 17..364 100   Plus

BO18393.3prime Sequence

380 bp (380 high quality bases) assembled on 2006-10-13

> BO18393.3prime
ATGGTCTAGAAAGCTTGCGCCAGTGCCTTCCGTTTTCTTTTTTTCGCCCC
CAACTTCGACCGGGAGAGGTGGAAAATGTGCCAACCTTTCCAAGTTTTTC
TTTGCTTCTTGGGGGGTGTGGAAAGGAAAAAGGAAATTTTTTGCCTTCAC
TTCACCGCTTTGTTTACGACCAAATCCAAAACAATGGCATTTTTGCACAT
GAGCGCATTTAAGCCAAGTTCTGCTGCCTGTCGTTGTCGATGTGGTTCTT
GTTCTTGTTATTGTTGTTGTTGTTGCTCTTACACTTAAACTAAACTTTTC
AACTGCTATTTTCTGATGCTCCTTCCGTGTGACTAAGAGTCTTCCTGGTC
TCGACTTGTGCTGCATGTCGACTGATAACT

BO18393.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG31246-PA 351 CG31246-RA 1..348 366..19 1740 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed on 2015-02-10 16:14:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17836945..17837292 366..19 1740 100 Minus
Blast to na_te.dros performed on 2015-02-10 16:14:46 has no hits.

BO18393.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:22:12 Download gff for BO18393.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31246-PA 1..351 18..366 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:45:09 Download gff for BO18393.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 17836945..17837292 19..366 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:45:09 Download gff for BO18393.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 17836945..17837292 19..366 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:11:59 Download gff for BO18393.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13662667..13663014 19..366 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 20:11:59 Download gff for BO18393.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13662667..13663014 19..366 100   Minus

BO18393.complete Sequence

382 bp assembled on 2006-10-11

GenBank Submission: FJ634403

> BO18393.complete
GAAGTTATCAGTCGACATGCAGCACAAGTCGAGACCAGGAAGACTCTTAG
TCACACGGAAGGAGCATCAGAAAATAGCAGTTGAAAAGTTTAGTTTAAGT
GTAAGAGCAACAACAACAACAATAACAAGAACAAGAACCACATCGACAAC
GACAGGCAGCAGAACTTGGCTTAAATGCGCTCATGTGCAAAAATGCCATT
GTTTTGGATTTGGTCGTAAACAAAGCGGTGAAGTGAAGGCAAAAAATTTC
CTTTTTCCTTTCCACACCCCCCAAGAAGCAAAGAAAAACTTGGAAAGGTT
GGCACATTTTCCACCTCTCCCGGTCGAAGTTGGGGGCGAAAAAAAGAAAA
CGGAAGGCACTGGCGCAAGCTTTCTAGACCAT

BO18393.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 16:14:33 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 16:14:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17836945..17837292 17..364 1740 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:14:32 has no hits.

BO18393.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:57:27 Download gff for BO18393.complete
Subject Subject Range Query Range Percent Splice Strand
CG31246-RA 1..351 17..365 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:02 Download gff for BO18393.complete
Subject Subject Range Query Range Percent Splice Strand
CG31246-RA 1143..1490 17..364 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:57:27 Download gff for BO18393.complete
Subject Subject Range Query Range Percent Splice Strand
CG31246-RA 1143..1490 17..364 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:14:10 Download gff for BO18393.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17836945..17837292 17..366 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:14:10 Download gff for BO18393.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17836945..17837292 17..366 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:51:14 Download gff for BO18393.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13662667..13663014 17..366 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:51:14 Download gff for BO18393.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13662667..13663014 17..366 99   Plus

BO18393.pep Sequence

Translation from 16 to 382

> BO18393.pep
MQHKSRPGRLLVTRKEHQKIAVEKFSLSVRATTTTITRTRTTSTTTGSRT
WLKCAHVQKCHCFGFGRKQSGEVKAKNFLFPFHTPQEAKKNLERLAHFPP
LPVEVGGEKKKTEGTGASFLDH
Sequence BO18393.pep has no blast hits.