Clone BO18446 Report

Search the DGRC for BO18446

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:184
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptCG13215-RA
Protein status:BO18446.pep: validated full length
Sequenced Size:382

Clone Sequence Records

BO18446.5prime Sequence

381 bp (381 high quality bases) assembled on 2006-10-13

> BO18446.5prime
GAAGTTATCACCTCGACATGAAGTGCATCATATCCATCGTTGTGATCTCC
ATGATCTTCGGTTTAAGCCTGATCCAAGCAGCACCCATCGCTAAGGATGC
CCAGAATCCAGGATTCGTTTCGGCCACGGATATTACCGGAGAGCCAGTGC
GCCAGAAGCGATCCAGTGCGGATTACTACCAGGGCGACTATTTCATCTGC
TATCCCAAGAGCGCAGTGTACGGCAAACATGGATACGGTGCAACCAATCG
CAGATCCTACGACTCGGAAGACTATGCGCCCCACTATTTGGCCGACGATC
CATTGGTCGTTCGCCAGGCTCGTGCTGATGCCAGACGCGCCGCCTACACC
GACAGCTTTGGCAAAGCAAGCTTTCTAGACC

BO18446.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-PA 351 CG13215-RA 1..348 18..365 1740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 10:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-RA 621 CG13215-RA 95..444 16..365 1750 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 10:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11239671..11240020 365..16 1750 100 Minus
Blast to na_te.dros performed on 2015-01-31 10:13:29 has no hits.

BO18446.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:23:02 Download gff for BO18446.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13215-PA 1..351 18..369 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 23:35:15 Download gff for BO18446.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 95..447 16..369 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:44:32 Download gff for BO18446.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 95..447 16..369 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 12:44:32 Download gff for BO18446.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 11239667..11240020 16..369 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 23:35:15 Download gff for BO18446.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7127172..7127525 16..369 99   Minus

BO18446.complete Sequence

382 bp assembled on 2006-10-11

GenBank Submission: FJ634417

> BO18446.complete
GAAGTTATCAGTCGACATGAAGTGCATCATATCCATCGTTGTGATCTCCA
TGATCTTCGGTTTAAGCCTGATCCAAGCAGCACCCATCGCTAAGGATGCC
CAGAATCCAGGATTCGTTTCGGCCACGGATATTACCGGAGAGCCAGTGCG
CCAGAAGCGATCCAGTGCGGATTACTACCAGGGCGACTATTTCATCTGCT
ATCCCAAGAGCGCAGTGTACGGCAAACATGGATACGGTGCAACCAATCGC
AGATCCTACGACTCGGAAGACTATGCGCCCCACTATTTGGCCGACGATCC
ATTGGTCGTTCGCCAGGCTCGTGCTGATGCCAGACGCGCCGCCTACACCG
ACAGCTTTGGCAAAGCAAGCTTTCTAGACCAT

BO18446.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-RA 351 CG13215-PA 1..348 17..364 1740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-RA 621 CG13215-RA 95..444 15..364 1750 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11239671..11240020 364..15 1750 100 Minus
Blast to na_te.dros performed on 2014-11-27 12:57:05 has no hits.

BO18446.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:20:38 Download gff for BO18446.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..351 17..368 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:39:33 Download gff for BO18446.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..351 17..368 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:47:16 Download gff for BO18446.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 97..444 17..366 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:20:39 Download gff for BO18446.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..351 17..368 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:07:55 Download gff for BO18446.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 97..444 17..366 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:07:55 Download gff for BO18446.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11239669..11240018 17..366 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:47:16 Download gff for BO18446.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7127174..7127523 17..366 99   Minus

BO18446.pep Sequence

Translation from 16 to 382

> BO18446.pep
MKCIISIVVISMIFGLSLIQAAPIAKDAQNPGFVSATDITGEPVRQKRSS
ADYYQGDYFICYPKSAVYGKHGYGATNRRSYDSEDYAPHYLADDPLVVRQ
ARADARRAAYTDSFGKASFLDH

BO18446.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-PA 116 CG13215-PA 1..116 1..116 605 100 Plus