Clone Sequence Records
BO18538.3prime Sequence
338 bp (338 high quality bases) assembled on 2006-10-13
> BO18538.3prime
ATGGTCTAGAAAGCTTGCATGTTTTATGTCAAAGGAAGTGAACGTATAGT
CCTCGATTTCCTGGATTTGCGAAAATTCAGCCTTTGAGACCTTAGCGTTG
GGAATTCGGTTGTTCTCCAGCCAATGTTTCATTTCCATTAAATTCATCAT
AGGAGCCTCCAGTTGTCCCTTGACGGTCCCATCCCGGGTATTCATGCACC
AGCCCCTAACTCCCAATCTTTTAGCCTCATGCGACGTGTGTTTGCGGAAG
AACACACCTTGCACTCGTCCAAAGATCTCGAAATCGAGGGCAAATATCTG
CTTGGCAACTCCAGATCCCGCCATGTCGACTGATAACT
BO18538.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:22:46
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG18505-PA | 309 | Acyp2-RA | 1..306 | 324..19 | 1530 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:17:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acyp2-RB | 619 | CG18505-RB | 148..453 | 324..19 | 1530 | 100 | Minus |
| Acyp2-RA | 543 | CG18505-RA | 148..453 | 324..19 | 1530 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:17:03
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 15793210..15793321 | 130..19 | 560 | 100 | Minus |
| 3R | 32079331 | 3R | 15793042..15793152 | 240..130 | 555 | 100 | Minus |
| 3R | 32079331 | 3R | 15792835..15792903 | 324..256 | 345 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 11:17:05 has no hits.
BO18538.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:24:21 Download gff for
BO18538.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG18505-PA | 1..309 | 15..324 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 00:46:55 Download gff for
BO18538.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acyp2-RA | 144..456 | 15..332 | 98 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:31:08 Download gff for
BO18538.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acyp2-RA | 144..456 | 15..332 | 98 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:31:08 Download gff for
BO18538.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 15793042..15793151 | 131..240 | 100 | -> | Minus |
| 3R | 15793210..15793324 | 15..130 | 98 | | Minus |
| 3R | 15792831..15792901 | 258..332 | 94 | -> | Minus |
| 3R | 15792957..15792973 | 241..257 | 100 | -> | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 00:46:55 Download gff for
BO18538.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 11618553..11618623 | 258..332 | 94 | -> | Minus |
| arm_3R | 11618679..11618695 | 241..257 | 100 | -> | Minus |
| arm_3R | 11618764..11618873 | 131..240 | 100 | -> | Minus |
| arm_3R | 11618932..11619046 | 15..130 | 98 | | Minus |
BO18538.5prime Sequence
338 bp (338 high quality bases) assembled on 2006-10-13
> BO18538.5prime
GAAGTTATCAGTCGACATGGCGGGATCTGGAGTTGCCAAGCAGATATTTG
CCCTCGATTTCGAGATCTTTGGACGAGTGCAAGGTGTGTTCTTCCGCAAA
CACACGTCGCATGAGGCTAAAAGATTGGGAGTTAGGGGCTGGTGCATGAA
TACCCGGGATGGGACCGTCAAGGGACAACTGGAGGCTCCTATGATGAATT
TAATGGAAATGAAACATTGGCTGGAGAACAACCGAATTCCCAACGCTAAG
GTCTCAAAGGCTGAATTTTCGCAAATCCAGGAAATCGAGGACTATACGTT
CACTTCCTTTGACATAAAACATGCAAGCTTTCTAGACC
BO18538.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:22:47
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG18505-PA | 309 | Acyp2-RA | 1..306 | 17..322 | 1530 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:40:28
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acyp2-RB | 619 | CG18505-RB | 148..453 | 17..322 | 1530 | 100 | Plus |
| Acyp2-RA | 543 | CG18505-RA | 148..453 | 17..322 | 1530 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:40:22
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 15793210..15793321 | 211..322 | 560 | 100 | Plus |
| 3R | 32079331 | 3R | 15793042..15793152 | 101..211 | 555 | 100 | Plus |
| 3R | 32079331 | 3R | 15792835..15792903 | 17..85 | 345 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 21:40:25 has no hits.
BO18538.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:24:22 Download gff for
BO18538.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG18505-PA | 1..309 | 17..326 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:07:25 Download gff for
BO18538.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acyp2-RA | 144..456 | 9..326 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:44:14 Download gff for
BO18538.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acyp2-RA | 144..456 | 9..326 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:44:14 Download gff for
BO18538.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 15792831..15792901 | 9..83 | 94 | -> | Plus |
| 3R | 15792957..15792973 | 84..100 | 100 | -> | Plus |
| 3R | 15793042..15793151 | 101..210 | 100 | -> | Plus |
| 3R | 15793210..15793324 | 211..326 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:07:25 Download gff for
BO18538.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 11618553..11618623 | 9..83 | 94 | -> | Plus |
| arm_3R | 11618679..11618695 | 84..100 | 100 | -> | Plus |
| arm_3R | 11618764..11618873 | 101..210 | 100 | -> | Plus |
| arm_3R | 11618932..11619046 | 211..326 | 98 | | Plus |
BO18538.complete Sequence
340 bp assembled on 2006-10-11
GenBank Submission: FJ634461
> BO18538.complete
GAAGTTATCAGTCGACATGGCGGGATCTGGAGTTGCCAAGCAGATATTTG
CCCTCGATTTCGAGATCTTTGGACGAGTGCAAGGTGTGTTCTTCCGCAAA
CACACGTCGCATGAGGCTAAAAGATTGGGAGTTAGGGGCTGGTGCATGAA
TACCCGGGATGGGACCGTCAAGGGACAACTGGAGGCTCCTATGATGAATT
TAATGGAAATGAAACATTGGCTGGAGAACAACCGAATTCCCAACGCTAAG
GTCTCAAAGGCTGAATTTTCGCAAATCCAGGAAATCGAGGACTATACGTT
CACTTCCTTTGACATAAAACATGCAAGCTTTCTAGACCAT
BO18538.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:45:48
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acyp2-RB | 309 | CG18505-PB | 1..306 | 17..322 | 1530 | 100 | Plus |
| Acyp2-RA | 309 | CG18505-PA | 1..306 | 17..322 | 1530 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:45:49
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acyp2-RB | 619 | CG18505-RB | 148..453 | 17..322 | 1530 | 100 | Plus |
| Acyp2-RA | 543 | CG18505-RA | 148..453 | 17..322 | 1530 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:45:46
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 15793210..15793321 | 211..322 | 560 | 100 | Plus |
| 3R | 32079331 | 3R | 15793042..15793152 | 101..211 | 555 | 100 | Plus |
| 3R | 32079331 | 3R | 15792835..15792903 | 17..85 | 345 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 01:45:47 has no hits.
BO18538.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:57:24 Download gff for
BO18538.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acyp2-RA | 1..309 | 17..326 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:06:46 Download gff for
BO18538.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acyp2-RA | 93..405 | 9..326 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:01:21 Download gff for
BO18538.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acyp2-RA | 148..453 | 17..324 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:57:24 Download gff for
BO18538.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acyp2-RA | 93..405 | 9..326 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:31:22 Download gff for
BO18538.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acyp2-RA | 148..453 | 17..324 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:31:22 Download gff for
BO18538.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 15792835..15792901 | 17..83 | 100 | -> | Plus |
| 3R | 15792957..15792973 | 84..100 | 100 | -> | Plus |
| 3R | 15793042..15793151 | 101..210 | 100 | -> | Plus |
| 3R | 15793210..15793321 | 211..324 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:01:21 Download gff for
BO18538.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 11618557..11618623 | 17..83 | 100 | -> | Plus |
| arm_3R | 11618679..11618695 | 84..100 | 100 | -> | Plus |
| arm_3R | 11618764..11618873 | 101..210 | 100 | -> | Plus |
| arm_3R | 11618932..11619043 | 211..324 | 98 | | Plus |
BO18538.pep Sequence
Translation from 16 to 340
> BO18538.pep
MAGSGVAKQIFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGT
VKGQLEAPMMNLMEMKHWLENNRIPNAKVSKAEFSQIQEIEDYTFTSFDI
KHASFLDH
BO18538.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:20:41
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acyp2-PB | 102 | CG18505-PB | 1..102 | 1..102 | 540 | 100 | Plus |
| Acyp2-PA | 102 | CG18505-PA | 1..102 | 1..102 | 540 | 100 | Plus |
| CG34161-PC | 125 | CG34161-PC | 32..124 | 9..101 | 245 | 47.3 | Plus |
| CG34161-PA | 125 | CG34161-PA | 32..124 | 9..101 | 245 | 47.3 | Plus |
| CG11052-PD | 149 | CG11052-PD | 56..146 | 10..100 | 233 | 44 | Plus |
