Clone BO18539 Report

Search the DGRC for BO18539

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:185
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptAcp53C14a-RA
Protein status:BO18539.pep: validated full length
Sequenced Size:397

Clone Sequence Records

BO18539.3prime Sequence

395 bp (395 high quality bases) assembled on 2006-10-13

> BO18539.3prime
ATGGTCTAGAAAGCTTGCCTCATCAAAGCACCTCAAGCTATCAAACTTGG
CTATAATCGGTCTAATCAGTCCGACTCCGGTGGTAAAGGTTTGTACGAGA
CATTCCGGTCGATCGTATATCGCCTTCTTGCCAAACTGATGGGCCACCCT
AATAAATCTGAGAATGCTACCAGTTAGTTTGATTTTCGGCTGAAAATCAA
CGCAATCGGATAGGAGGCTTATGGCCGTTATAGAGTTCTCGATCATTAGG
GCACCGGCATCAGTCACCACTTCCAAACATCGCAGATAGTGATCGAGTTC
CGAACTTATGGCGGCTTGAACTTGCGACTTTTGGCATAAAGCCAAAAAGC
TTAGTAACAAGGCGATCTTAATCAAATGCATGTCGACTGATAACT

BO18539.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG8626-PA 366 Acp53C14a-RA 1..363 381..19 1815 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14a-RB 705 CG8626-RB 44..406 381..19 1815 100 Minus
Acp53C14a-RA 479 CG8626-RA 44..406 381..19 1815 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16748133..16748453 19..339 1605 100 Plus
2R 25286936 2R 16748506..16748547 340..381 210 100 Plus
Blast to na_te.dros performed 2015-02-10 21:11:45
Subject Length Description Subject Range Query Range Score Percent Strand
transib3 2883 transib3 TRANSIB3 2883bp 24..52 329..357 109 86.2 Plus

BO18539.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:24:22 Download gff for BO18539.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8626-PA 1..366 15..381 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:26:30 Download gff for BO18539.3prime
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 26..392 14..381 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:42:51 Download gff for BO18539.3prime
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 44..410 14..381 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:42:51 Download gff for BO18539.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 16748129..16748453 14..339 99 <- Plus
2R 16748506..16748547 340..381 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:26:30 Download gff for BO18539.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12635634..12635958 14..339 99 <- Plus
arm_2R 12636011..12636052 340..381 100   Plus

BO18539.5prime Sequence

395 bp (395 high quality bases) assembled on 2006-10-13

> BO18539.5prime
GAAGTTATCAGTCGACATGCATTTGATTAAGATCGCCTTGTTACTAAGCT
TTTTGGCTTTATGCCAAAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAA
CTCGATCACTATCTGCGATGTTTGGAAGTGGTGACTGATGCCGGTGCCCT
AATGATCGAGAACTCTATAACGGCCATAAGCCTCCTATCCGATTGCGTTG
ATTTTCAGCCGAAAATCAAACTAACTGGTAGCATTCTCAGATTTATTAGG
GTGGCCCATCAGTTTGGCAAGAAGGCGATATACGATCGACCGGAATGTCT
CGTACAAACCTTTACCACCGGAGTCGGACTGATTAGACCGATTATAGCCA
AGTTTGATAGCTTGAGGTGCTTTGATGAGGCAAGCTTTCTAGACC

BO18539.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG8626-PA 366 Acp53C14a-RA 1..363 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14a-RB 705 CG8626-RB 44..406 17..379 1815 100 Plus
Acp53C14a-RA 479 CG8626-RA 44..406 17..379 1815 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:07:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16748133..16748453 379..59 1605 100 Minus
2R 25286936 2R 16748506..16748547 58..17 210 100 Minus
Blast to na_te.dros performed 2015-02-10 17:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
transib3 2883 transib3 TRANSIB3 2883bp 24..52 69..41 109 86.2 Minus

BO18539.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:24:22 Download gff for BO18539.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8626-PA 1..366 17..383 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:23:15 Download gff for BO18539.5prime
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 26..392 17..384 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:07:14 Download gff for BO18539.5prime
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 44..410 17..384 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:07:14 Download gff for BO18539.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 16748129..16748453 59..384 99 <- Minus
2R 16748506..16748547 17..58 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:23:15 Download gff for BO18539.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12635634..12635958 59..384 99 <- Minus
arm_2R 12636011..12636052 17..58 100   Minus

BO18539.complete Sequence

397 bp assembled on 2006-10-11

GenBank Submission: FJ634462

> BO18539.complete
GAAGTTATCAGTCGACATGCATTTGATTAAGATCGCCTTGTTACTAAGCT
TTTTGGCTTTATGCCAAAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAA
CTCGATCACTATCTGCGATGTTTGGAAGTGGTGACTGATGCCGGTGCCCT
AATGATCGAGAACTCTATAACGGCCATAAGCCTCCTATCCGATTGCGTTG
ATTTTCAGCCGAAAATCAAACTAACTGGTAGCATTCTCAGATTTATTAGG
GTGGCCCATCAGTTTGGCAAGAAGGCGATATACGATCGACCGGAATGTCT
CGTACAAACCTTTACCACCGGAGTCGGACTGATTAGACCGATTATAGCCA
AGTTTGATAGCTTGAGGTGCTTTGATGAGGCAAGCTTTCTAGACCAT

BO18539.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14a-RB 366 CG8626-PB 1..363 17..379 1815 100 Plus
Acp53C14a-RA 366 CG8626-PA 1..363 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14a-RB 705 CG8626-RB 44..406 17..379 1815 100 Plus
Acp53C14a-RA 479 CG8626-RA 44..406 17..379 1815 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16748133..16748453 379..59 1605 100 Minus
2R 25286936 2R 16748506..16748547 58..17 210 100 Minus
Blast to na_te.dros performed 2014-11-27 14:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
transib3 2883 transib3 TRANSIB3 2883bp 24..52 69..41 109 86.2 Minus

BO18539.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:20:07 Download gff for BO18539.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 1..366 17..383 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:38:47 Download gff for BO18539.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 26..392 17..384 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:32:26 Download gff for BO18539.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 26..388 17..381 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:20:07 Download gff for BO18539.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 15..381 17..384 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:51:52 Download gff for BO18539.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 44..406 17..381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:51:52 Download gff for BO18539.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16748131..16748453 59..381 99 <- Minus
2R 16748506..16748547 17..58 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:32:26 Download gff for BO18539.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12635636..12635958 59..381 99 <- Minus
arm_2R 12636011..12636052 17..58 100   Minus

BO18539.pep Sequence

Translation from 16 to 397

> BO18539.pep
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDEASFLDH

BO18539.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14a-PB 121 CG8626-PB 1..121 1..121 608 100 Plus
Acp53C14a-PA 121 CG8626-PA 1..121 1..121 608 100 Plus
Acp53Ea-PA 120 CG8622-PA 1..120 1..121 155 28.1 Plus
Acp53C14b-PB 132 CG15616-PB 1..131 1..125 140 26 Plus
Acp53C14b-PA 132 CG15616-PA 1..131 1..125 140 26 Plus