Clone Sequence Records
BO18547.3prime Sequence
338 bp (338 high quality bases) assembled on 2006-10-13
> BO18547.3prime
ATGGTCTAGAAAGCTTGCGCAGTGATGATGATGATGTCCATGGTGAGGAC
CATGATGATGGTCAAAGTGGCTGCCGTGGTGATGATGATGATGATCGTAG
TGGGGCGGCGGTGGCGGAGGTCCGTAGTGGTGGTGGTGGTGCGGCGGGGG
TCCGTGGTGGTGCATTGGAGGTCCGTGGTGGTGATGGTGGTGCACCGGAG
GCGGTGGGTGATAGTGGTGCACCGGAGGCGGTGGATGATGGTGGTGGTGA
TGATGTCCACCTCCACCCAAATTCAGGCCAAGGTGGATTCCAAACAGGCG
ATTTTCGTGATGTGGCGGCGACATGTCGACTGATAACT
BO18547.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:23:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-PA | 309 | CG13482-RA | 1..306 | 324..19 | 1530 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:09:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-RA | 540 | CG13482-RA | 92..397 | 324..19 | 1530 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:09:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 14329437..14329742 | 324..19 | 1530 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 17:09:45 has no hits.
BO18547.3prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:24:30 Download gff for
BO18547.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-PA | 1..309 | 18..324 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:23:36 Download gff for
BO18547.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 84..397 | 19..332 | 99 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:07:30 Download gff for
BO18547.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 84..397 | 19..332 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:07:30 Download gff for
BO18547.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14329429..14329742 | 19..332 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:23:36 Download gff for
BO18547.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 14322529..14322842 | 19..332 | 99 | | Minus |
BO18547.5prime Sequence
338 bp (338 high quality bases) assembled on 2006-10-13
> BO18547.5prime
GAAGTTATCAGTCGACATGTCGCCGCCACATCACGAAAATCGCCTGTTTG
GAATCCACCTTGGCCTGAATTTGGGTGGAGGTGGACATCATCACCACCAC
CATCATCCACCGCCTCCGGTGCACCACTATCACCCACCGCCTCCGGTGCA
CCACCATCACCACCACGGACCTCCAATGCACCACCACGGACCCCCGCCGC
ACCACCACCACCACTACGGACCTCCGCCACCGCCGCCCCACTACGATCAT
CATCATCATCACCACGGCAGCCACTTTGACCATCATCATGGTCCTCACCA
TGGACATCATCATCATCACTGCGCAAGCTTTCTAGACC
BO18547.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:23:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-PA | 309 | CG13482-RA | 1..306 | 17..322 | 1530 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:12:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-RA | 540 | CG13482-RA | 92..397 | 17..322 | 1530 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:12:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 14329437..14329742 | 17..322 | 1530 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 21:12:55 has no hits.
BO18547.5prime Sim4 Records
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:24:31 Download gff for
BO18547.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-PA | 1..309 | 17..323 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:26:45 Download gff for
BO18547.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 84..397 | 9..322 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:45:06 Download gff for
BO18547.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 84..397 | 9..322 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:45:06 Download gff for
BO18547.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14329429..14329742 | 9..322 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:26:45 Download gff for
BO18547.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 14322529..14322842 | 9..322 | 99 | | Plus |
BO18547.complete Sequence
340 bp assembled on 2006-10-11
GenBank Submission: FJ634468
> BO18547.complete
GAAGTTATCAGTCGACATGTCGCCGCCACATCACGAAAATCGCCTGTTTG
GAATCCACCTTGGCCTGAATTTGGGTGGAGGTGGACATCATCACCACCAC
CATCATCCACCGCCTCCGGTGCACCACTATCACCCACCGCCTCCGGTGCA
CCACCATCACCACCACGGACCTCCAATGCACCACCACGGACCCCCGCCGC
ACCACCACCACCACTACGGACCTCCGCCACCGCCGCCCCACTACGATCAT
CATCATCATCACCACGGCAGCCACTTTGACCATCATCATGGTCCTCACCA
TGGACATCATCATCATCACTGCGCAAGCTTTCTAGACCAT
BO18547.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:21:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-RA | 309 | CG13482-PA | 1..306 | 17..322 | 1530 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:21:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-RA | 540 | CG13482-RA | 92..397 | 17..322 | 1530 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:21:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 14329437..14329742 | 17..322 | 1530 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 13:21:26 has no hits.
BO18547.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:19:51 Download gff for
BO18547.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 1..309 | 17..323 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:02:06 Download gff for
BO18547.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 1..309 | 17..323 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:29:05 Download gff for
BO18547.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 92..397 | 17..324 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:19:51 Download gff for
BO18547.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 1..309 | 17..323 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:16:34 Download gff for
BO18547.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13482-RA | 92..397 | 17..324 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:16:34 Download gff for
BO18547.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14329437..14329742 | 17..324 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:29:05 Download gff for
BO18547.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 14322537..14322842 | 17..324 | 99 | | Plus |
BO18547.pep Sequence
Translation from 16 to 340
> BO18547.pep
MSPPHHENRLFGIHLGLNLGGGGHHHHHHHPPPPVHHYHPPPPVHHHHHH
GPPMHHHGPPPHHHHHYGPPPPPPHYDHHHHHHGSHFDHHHGPHHGHHHH
HCASFLDH
BO18547.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:50:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13482-PA | 102 | CG13482-PA | 1..102 | 1..102 | 708 | 100 | Plus |
CG43349-PB | 70 | CG43349-PB | 6..64 | 24..84 | 202 | 58.5 | Plus |
CG43349-PA | 70 | CG43349-PA | 6..64 | 24..84 | 202 | 58.5 | Plus |
CG43349-PB | 70 | CG43349-PB | 2..68 | 40..100 | 200 | 56.9 | Plus |
CG43349-PA | 70 | CG43349-PA | 2..68 | 40..100 | 200 | 56.9 | Plus |
CG5225-PA | 594 | CG5225-PA | 323..398 | 20..99 | 191 | 46.5 | Plus |
CG5225-PA | 594 | CG5225-PA | 290..398 | 14..101 | 176 | 38.4 | Plus |
CG43355-PC | 170 | CG43355-PC | 1..106 | 15..85 | 166 | 36.8 | Plus |
CG5225-PA | 594 | CG5225-PA | 343..435 | 3..101 | 156 | 33 | Plus |
CG43349-PB | 70 | CG43349-PB | 7..69 | 24..73 | 150 | 51.5 | Plus |
CG43349-PA | 70 | CG43349-PA | 7..69 | 24..73 | 150 | 51.5 | Plus |
CG5225-PA | 594 | CG5225-PA | 147..211 | 24..85 | 145 | 41.9 | Plus |