Clone BO18547 Report

Search the DGRC for BO18547

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:185
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG13482-RA
Protein status:BO18547.pep: validated full length
Sequenced Size:340

Clone Sequence Records

BO18547.3prime Sequence

338 bp (338 high quality bases) assembled on 2006-10-13

> BO18547.3prime
ATGGTCTAGAAAGCTTGCGCAGTGATGATGATGATGTCCATGGTGAGGAC
CATGATGATGGTCAAAGTGGCTGCCGTGGTGATGATGATGATGATCGTAG
TGGGGCGGCGGTGGCGGAGGTCCGTAGTGGTGGTGGTGGTGCGGCGGGGG
TCCGTGGTGGTGCATTGGAGGTCCGTGGTGGTGATGGTGGTGCACCGGAG
GCGGTGGGTGATAGTGGTGCACCGGAGGCGGTGGATGATGGTGGTGGTGA
TGATGTCCACCTCCACCCAAATTCAGGCCAAGGTGGATTCCAAACAGGCG
ATTTTCGTGATGTGGCGGCGACATGTCGACTGATAACT

BO18547.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-PA 309 CG13482-RA 1..306 324..19 1530 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-RA 540 CG13482-RA 92..397 324..19 1530 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14329437..14329742 324..19 1530 100 Minus
Blast to na_te.dros performed on 2015-02-10 17:09:45 has no hits.

BO18547.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:24:30 Download gff for BO18547.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13482-PA 1..309 18..324 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 20:23:36 Download gff for BO18547.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 84..397 19..332 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:07:30 Download gff for BO18547.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 84..397 19..332 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:07:30 Download gff for BO18547.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 14329429..14329742 19..332 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 20:23:36 Download gff for BO18547.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14322529..14322842 19..332 99   Minus

BO18547.5prime Sequence

338 bp (338 high quality bases) assembled on 2006-10-13

> BO18547.5prime
GAAGTTATCAGTCGACATGTCGCCGCCACATCACGAAAATCGCCTGTTTG
GAATCCACCTTGGCCTGAATTTGGGTGGAGGTGGACATCATCACCACCAC
CATCATCCACCGCCTCCGGTGCACCACTATCACCCACCGCCTCCGGTGCA
CCACCATCACCACCACGGACCTCCAATGCACCACCACGGACCCCCGCCGC
ACCACCACCACCACTACGGACCTCCGCCACCGCCGCCCCACTACGATCAT
CATCATCATCACCACGGCAGCCACTTTGACCATCATCATGGTCCTCACCA
TGGACATCATCATCATCACTGCGCAAGCTTTCTAGACC

BO18547.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-11 11:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-PA 309 CG13482-RA 1..306 17..322 1530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-RA 540 CG13482-RA 92..397 17..322 1530 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14329437..14329742 17..322 1530 100 Plus
Blast to na_te.dros performed on 2015-02-10 21:12:55 has no hits.

BO18547.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 13:24:31 Download gff for BO18547.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13482-PA 1..309 17..323 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 06:26:45 Download gff for BO18547.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 84..397 9..322 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:45:06 Download gff for BO18547.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 84..397 9..322 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:45:06 Download gff for BO18547.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 14329429..14329742 9..322 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 06:26:45 Download gff for BO18547.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14322529..14322842 9..322 99   Plus

BO18547.complete Sequence

340 bp assembled on 2006-10-11

GenBank Submission: FJ634468

> BO18547.complete
GAAGTTATCAGTCGACATGTCGCCGCCACATCACGAAAATCGCCTGTTTG
GAATCCACCTTGGCCTGAATTTGGGTGGAGGTGGACATCATCACCACCAC
CATCATCCACCGCCTCCGGTGCACCACTATCACCCACCGCCTCCGGTGCA
CCACCATCACCACCACGGACCTCCAATGCACCACCACGGACCCCCGCCGC
ACCACCACCACCACTACGGACCTCCGCCACCGCCGCCCCACTACGATCAT
CATCATCATCACCACGGCAGCCACTTTGACCATCATCATGGTCCTCACCA
TGGACATCATCATCATCACTGCGCAAGCTTTCTAGACCAT

BO18547.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-RA 309 CG13482-PA 1..306 17..322 1530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-RA 540 CG13482-RA 92..397 17..322 1530 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14329437..14329742 17..322 1530 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:21:26 has no hits.

BO18547.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:19:51 Download gff for BO18547.complete
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 1..309 17..323 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:02:06 Download gff for BO18547.complete
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 1..309 17..323 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:29:05 Download gff for BO18547.complete
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 92..397 17..324 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:19:51 Download gff for BO18547.complete
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 1..309 17..323 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:16:34 Download gff for BO18547.complete
Subject Subject Range Query Range Percent Splice Strand
CG13482-RA 92..397 17..324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:16:34 Download gff for BO18547.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14329437..14329742 17..324 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:29:05 Download gff for BO18547.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14322537..14322842 17..324 99   Plus

BO18547.pep Sequence

Translation from 16 to 340

> BO18547.pep
MSPPHHENRLFGIHLGLNLGGGGHHHHHHHPPPPVHHYHPPPPVHHHHHH
GPPMHHHGPPPHHHHHYGPPPPPPHYDHHHHHHGSHFDHHHGPHHGHHHH
HCASFLDH

BO18547.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13482-PA 102 CG13482-PA 1..102 1..102 708 100 Plus
CG43349-PB 70 CG43349-PB 6..64 24..84 202 58.5 Plus
CG43349-PA 70 CG43349-PA 6..64 24..84 202 58.5 Plus
CG43349-PB 70 CG43349-PB 2..68 40..100 200 56.9 Plus
CG43349-PA 70 CG43349-PA 2..68 40..100 200 56.9 Plus
CG5225-PA 594 CG5225-PA 323..398 20..99 191 46.5 Plus
CG5225-PA 594 CG5225-PA 290..398 14..101 176 38.4 Plus
CG43355-PC 170 CG43355-PC 1..106 15..85 166 36.8 Plus
CG5225-PA 594 CG5225-PA 343..435 3..101 156 33 Plus
CG43349-PB 70 CG43349-PB 7..69 24..73 150 51.5 Plus
CG43349-PA 70 CG43349-PA 7..69 24..73 150 51.5 Plus
CG5225-PA 594 CG5225-PA 147..211 24..85 145 41.9 Plus