Clone BO18608 Report

Search the DGRC for BO18608

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:186
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptCG13373-RA
Protein status:BO18608.pep: Imported from assembly
Sequenced Size:406

Clone Sequence Records

BO18608.complete Sequence

406 bp assembled on 2009-05-13

GenBank Submission: KX799205

> BO18608.complete
GAAGTTATCAGTCGACATGCTTTTCGATGGCGCAGCCGGCAATAGGCAGG
GTCAGGGCCAGAATGCCCTGAAGCCATTGGTACAAGGCCAGGAGGAGCCC
GCCCTATGCGAGCAGTACTATCTGCTTGGCGATGGTTCCATCGTTCTGCG
CAACCTTCGCACCGACTTGTCCAATCCGCGCCTGGAGAGAGTGAAATCGC
GCTGCTGCCAGCGCCAAACGCTCATCCACGACATATGCGTCAACTGCGTG
ATGGATCTCTGCGAGGAGTGTGGCTACTCCTGCGGCGAGTGCTCCAGGTT
CATTTGCCGCAGCTGCGTGACTTTATTTGGTAATCGAGTTGAAGAAGAGA
AGGATCCCCTGTGCGAGCACTGCCAGATGTTCTTCAGCGCAAGCTTTCTA
GACCAT

BO18608.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:00:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG13373-RB 534 CG13373-PB 160..531 17..388 1860 100 Plus
CG13373-RA 375 CG13373-PA 1..372 17..388 1860 100 Plus
CG3176-RD 366 CG3176-PD 1..363 17..388 1270 90.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13373-RB 812 CG13373-RB 323..694 17..388 1860 100 Plus
CG13373-RA 743 CG13373-RA 254..625 17..388 1860 100 Plus
CG3176-RD 627 CG3176-RD 75..437 17..388 1270 90.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:00:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 477621..477931 17..327 1555 100 Plus
X 23542271 X 479644..479945 17..327 1040 89.7 Plus
X 23542271 X 482132..482433 17..327 1025 89.4 Plus
X 23542271 X 478013..478073 328..388 305 100 Plus
X 23542271 X 482518..482578 328..388 245 93.4 Plus
X 23542271 X 480030..480090 328..388 230 91.8 Plus
Blast to na_te.dros performed on 2014-11-28 00:00:46 has no hits.

BO18608.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:39:19 Download gff for BO18608.complete
Subject Subject Range Query Range Percent Splice Strand
CG13373-RB 160..531 17..390 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:43:36 Download gff for BO18608.complete
Subject Subject Range Query Range Percent Splice Strand
CG13373-RA 254..625 17..390 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:12:46 Download gff for BO18608.complete
Subject Subject Range Query Range Percent Splice Strand
CG13373-RA 254..625 17..390 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:12:46 Download gff for BO18608.complete
Subject Subject Range Query Range Percent Splice Strand
X 477621..477931 17..327 100 -> Plus
X 478013..478073 328..390 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:43:36 Download gff for BO18608.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 371654..371964 17..327 100 -> Plus
arm_X 372046..372106 328..390 96   Plus

BO18608.pep Sequence

Translation from 16 to 406

> BO18608.pep
MLFDGAAGNRQGQGQNALKPLVQGQEEPALCEQYYLLGDGSIVLRNLRTD
LSNPRLERVKSRCCQRQTLIHDICVNCVMDLCEECGYSCGECSRFICRSC
VTLFGNRVEEEKDPLCEHCQMFFSASFLDH

BO18608.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 01:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG13373-PA 124 CG13373-PA 1..124 1..124 683 100 Plus
CG13373-PB 177 CG13373-PB 54..177 1..124 683 100 Plus
CG3176-PD 121 CG3176-PD 1..121 1..124 557 81.5 Plus
CG3176-PA 121 CG3176-PA 1..121 1..124 557 81.5 Plus
CG32817-PB 121 CG32817-PB 1..121 1..124 549 80.6 Plus