Clone BO18609 Report

Search the DGRC for BO18609

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:186
Well:9
Vector:pDNR-Dual
Associated Gene/Transcriptsmt3-RA
Protein status:BO18609.pep: Imported from assembly
Sequenced Size:304

Clone Sequence Records

BO18609.complete Sequence

304 bp assembled on 2009-05-13

GenBank Submission: KX796114

> BO18609.complete
GAAGTTATCAGTCGACATGTCTGACGAAAAGAAGGGAGGTGAGACCGAGC
ACATCAACCTGAAGGTCCTCGGCCAGGACAACGCCGTCGTCCAGTTCAAG
ATCAAGAAGCACACACCCTTGAGGAAGCTGATGAACGCCTACTGCGACCG
TGCCGGACTCTCCATGCAGGTGGTGCGCTTCCGTTTCGACGGACAGCCCA
TCAACGAGAACGACACTCCGACCTCGCTGGAGATGGAGGAGGGCGACACC
ATCGAGGTTTACCAGCAGCAGACTGGTGGCGCTCCAGCAAGCTTTCTAGA
CCAT

BO18609.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
smt3-RB 273 CG4494-PB 1..270 17..286 1350 100 Plus
smt3-RA 273 CG4494-PA 1..270 17..286 1350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
smt3-RB 689 CG4494-RB 167..438 15..286 1360 100 Plus
smt3-RA 743 CG4494-RA 221..492 15..286 1360 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6967031..6967302 286..15 1360 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:25:05 has no hits.

BO18609.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:39:26 Download gff for BO18609.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 172..441 17..288 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:53:28 Download gff for BO18609.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 223..492 17..288 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:18:00 Download gff for BO18609.complete
Subject Subject Range Query Range Percent Splice Strand
smt3-RA 223..492 17..288 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:18:00 Download gff for BO18609.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6967029..6967300 17..288 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:53:28 Download gff for BO18609.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6967029..6967300 17..288 99   Minus

BO18609.pep Sequence

Translation from 16 to 304

> BO18609.pep
MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSM
QVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGAPASFLDH

BO18609.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 01:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
smt3-PB 90 CG4494-PB 1..90 1..90 471 100 Plus
smt3-PA 90 CG4494-PA 1..90 1..90 471 100 Plus