BO18609.complete Sequence
304 bp assembled on 2009-05-13
GenBank Submission: KX796114
> BO18609.complete
GAAGTTATCAGTCGACATGTCTGACGAAAAGAAGGGAGGTGAGACCGAGC
ACATCAACCTGAAGGTCCTCGGCCAGGACAACGCCGTCGTCCAGTTCAAG
ATCAAGAAGCACACACCCTTGAGGAAGCTGATGAACGCCTACTGCGACCG
TGCCGGACTCTCCATGCAGGTGGTGCGCTTCCGTTTCGACGGACAGCCCA
TCAACGAGAACGACACTCCGACCTCGCTGGAGATGGAGGAGGGCGACACC
ATCGAGGTTTACCAGCAGCAGACTGGTGGCGCTCCAGCAAGCTTTCTAGA
CCAT
BO18609.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:25:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
smt3-RB | 273 | CG4494-PB | 1..270 | 17..286 | 1350 | 100 | Plus |
smt3-RA | 273 | CG4494-PA | 1..270 | 17..286 | 1350 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:25:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
smt3-RB | 689 | CG4494-RB | 167..438 | 15..286 | 1360 | 100 | Plus |
smt3-RA | 743 | CG4494-RA | 221..492 | 15..286 | 1360 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:25:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 6967031..6967302 | 286..15 | 1360 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 16:25:05 has no hits.
BO18609.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:39:26 Download gff for
BO18609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
smt3-RA | 172..441 | 17..288 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:53:28 Download gff for
BO18609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
smt3-RA | 223..492 | 17..288 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:18:00 Download gff for
BO18609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
smt3-RA | 223..492 | 17..288 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:18:00 Download gff for
BO18609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6967029..6967300 | 17..288 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:53:28 Download gff for
BO18609.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 6967029..6967300 | 17..288 | 99 | | Minus |
BO18609.pep Sequence
Translation from 16 to 304
> BO18609.pep
MSDEKKGGETEHINLKVLGQDNAVVQFKIKKHTPLRKLMNAYCDRAGLSM
QVVRFRFDGQPINENDTPTSLEMEEGDTIEVYQQQTGGAPASFLDH
BO18609.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 01:02:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
smt3-PB | 90 | CG4494-PB | 1..90 | 1..90 | 471 | 100 | Plus |
smt3-PA | 90 | CG4494-PA | 1..90 | 1..90 | 471 | 100 | Plus |