Clone BO18610 Report

Search the DGRC for BO18610

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:186
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG1368-RA
Protein status:BO18610.pep: Imported from assembly
Sequenced Size:592

Clone Sequence Records

BO18610.complete Sequence

592 bp assembled on 2009-05-13

GenBank Submission: KX795344

> BO18610.complete
GAAGTTATCAGTCGACATGAAATTCCTTATTGCCTTCGCCCTGTTCGCCT
GCGTGGCCGCCGATGTTAGCCACCTGAGCAACGAGTACCTGCCCCCCGTC
CAGAGCTCGTACGCCGCTCCCTCGGTGAGCTACTCCGCACCAGCCGTGCA
GCAGACCTACGCCGCTCCAGCCATCCAGCAGTCGTATGTCGCCCCCAGCA
ACGAGTACCTGCCTCCTGTGCAGACCTACTCCGCACCGGCCGTCCAGAGG
ACCTACTCCGCACCAGCTGTCCAGAGGACCTACTCCGCCCCCTCTGTTAG
CTACTCGGCACCCTCTGTGAGCTACTCGGCTCCATCGGTCAGCTACTCCG
CTCCTGCTGTCCAGCAGTCGTACTCCGCTCCATCGGTCAGCTACTCCGCC
CCTGCTGTCCAGCAGTCGTACTCCGCTCCATCGGTCAGCTACTCCGCCCC
TGCTGTCCAGCAGTCGTACTCCGCTCCTGCCGTCAGCTACTCCGCCCCAT
CGGTGAGCTACTCTGCACCCTCCGTGGATGTGGGCACCCAGTACGCCTCC
AACGGTGGCTACGTCTACAGGAAGGCAAGCTTTCTAGACCAT

BO18610.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:58:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG1368-RA 561 CG1368-PA 1..558 17..574 2790 100 Plus
CG1368-RA 561 CG1368-PA 307..434 371..498 565 96.1 Plus
CG1368-RA 561 CG1368-PA 355..482 323..450 565 96.1 Plus
CG1368-RA 561 CG1368-PA 307..386 419..498 325 93.8 Plus
CG1368-RA 561 CG1368-PA 403..482 323..402 325 93.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG1368-RA 774 CG1368-RA 72..629 17..574 2790 100 Plus
CG1368-RA 774 CG1368-RA 378..505 371..498 565 96.1 Plus
CG1368-RA 774 CG1368-RA 426..553 323..450 565 96.1 Plus
CG1368-RA 774 CG1368-RA 378..457 419..498 325 93.8 Plus
CG1368-RA 774 CG1368-RA 474..553 323..402 325 93.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:58:26
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14174970..14175525 19..574 2780 100 Plus
X 23542271 X 14175274..14175401 371..498 565 96.1 Plus
X 23542271 X 14175322..14175449 323..450 565 96.1 Plus
X 23542271 X 14175274..14175353 419..498 325 93.8 Plus
X 23542271 X 14175370..14175449 323..402 325 93.8 Plus
Blast to na_te.dros performed on 2014-11-27 10:58:27 has no hits.

BO18610.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:36:57 Download gff for BO18610.complete
Subject Subject Range Query Range Percent Splice Strand
CG1368-RA 67..624 17..576 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:43:31 Download gff for BO18610.complete
Subject Subject Range Query Range Percent Splice Strand
CG1368-RA 72..629 17..576 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:35 Download gff for BO18610.complete
Subject Subject Range Query Range Percent Splice Strand
CG1368-RA 72..629 17..576 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:35:35 Download gff for BO18610.complete
Subject Subject Range Query Range Percent Splice Strand
X 14174969..14175525 17..576 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:43:31 Download gff for BO18610.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14069002..14069558 17..576 99   Plus

BO18610.pep Sequence

Translation from 16 to 592

> BO18610.pep
MKFLIAFALFACVAADVSHLSNEYLPPVQSSYAAPSVSYSAPAVQQTYAA
PAIQQSYVAPSNEYLPPVQTYSAPAVQRTYSAPAVQRTYSAPSVSYSAPS
VSYSAPSVSYSAPAVQQSYSAPSVSYSAPAVQQSYSAPSVSYSAPAVQQS
YSAPAVSYSAPSVSYSAPSVDVGTQYASNGGYVYRKASFLDH

BO18610.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG1368-PA 186 CG1368-PA 1..186 1..186 932 100 Plus
CG32603-PA 345 CG32603-PA 156..345 14..184 389 51.8 Plus
CG32603-PA 345 CG32603-PA 1..244 1..174 343 44.3 Plus
CG11350-PC 456 CG11350-PC 1..161 1..178 343 50.8 Plus
CG11350-PC 456 CG11350-PC 235..444 21..185 317 42.6 Plus
CG34205-PA 217 CG34205-PA 23..212 1..173 311 39.9 Plus
CG11350-PC 456 CG11350-PC 108..302 31..185 282 42.2 Plus
CG11585-PB 342 CG11585-PB 100..298 14..181 280 46.1 Plus