Clone BO18615 Report

Search the DGRC for BO18615

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:186
Well:15
Vector:pDNR-Dual
Associated Gene/TranscriptGgamma1-RA
Protein status:BO18615.pep: Imported from assembly
Sequenced Size:244

Clone Sequence Records

BO18615.complete Sequence

244 bp assembled on 2009-05-13

GenBank Submission: KX796698

> BO18615.complete
GAAGTTATCAGTCGACATGGACGTAATGTCATCATCCCTGCAGCAGCAGC
GCGTCGTGGTGGAGCAGCTGCGTCGCGAGGCTGCCATCGACCGCCAGACG
ATCTCGGAGTCATGCGCTAAGATGATGAAGTACATCACGGAGCACGAGCA
GGAGGACTACCTGCTCACCGGGTTCACCAGCCAGAAGGTGAATCCCTTCC
GCGAGAAGTCGTCCTGCACCGTTCTCGCAAGCTTTCTAGACCAT

BO18615.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma1-RC 213 CG8261-PC 1..210 17..226 1050 100 Plus
Ggamma1-RB 213 CG8261-PB 1..210 17..226 1050 100 Plus
Ggamma1-RA 213 CG8261-PA 1..210 17..226 1050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:31:42
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma1-RC 831 CG8261-RC 48..258 16..226 1055 100 Plus
Ggamma1-RB 1084 CG8261-RB 301..511 16..226 1055 100 Plus
Ggamma1-RA 2554 CG8261-RA 110..320 16..226 1055 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8902347..8902557 16..226 1055 100 Plus
Blast to na_te.dros performed 2014-11-27 13:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 1526..1564 32..72 101 75.6 Plus

BO18615.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:39:28 Download gff for BO18615.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RB 332..541 17..228 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:51:32 Download gff for BO18615.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RA 111..320 17..228 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:20:30 Download gff for BO18615.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma1-RA 111..320 17..228 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:20:30 Download gff for BO18615.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8902348..8902557 17..228 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:51:32 Download gff for BO18615.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4789853..4790062 17..228 99   Plus

BO18615.pep Sequence

Translation from 16 to 244

> BO18615.pep
MDVMSSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLL
TGFTSQKVNPFREKSSCTVLASFLDH

BO18615.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 01:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma1-PC 70 CG8261-PC 1..70 1..70 349 100 Plus
Ggamma1-PB 70 CG8261-PB 1..70 1..70 349 100 Plus
Ggamma1-PA 70 CG8261-PA 1..70 1..70 349 100 Plus
CG43324-PA 66 CG43324-PA 1..66 4..70 209 61.2 Plus