BO18615.complete Sequence
244 bp assembled on 2009-05-13
GenBank Submission: KX796698
> BO18615.complete
GAAGTTATCAGTCGACATGGACGTAATGTCATCATCCCTGCAGCAGCAGC
GCGTCGTGGTGGAGCAGCTGCGTCGCGAGGCTGCCATCGACCGCCAGACG
ATCTCGGAGTCATGCGCTAAGATGATGAAGTACATCACGGAGCACGAGCA
GGAGGACTACCTGCTCACCGGGTTCACCAGCCAGAAGGTGAATCCCTTCC
GCGAGAAGTCGTCCTGCACCGTTCTCGCAAGCTTTCTAGACCAT
BO18615.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:31:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma1-RC | 213 | CG8261-PC | 1..210 | 17..226 | 1050 | 100 | Plus |
Ggamma1-RB | 213 | CG8261-PB | 1..210 | 17..226 | 1050 | 100 | Plus |
Ggamma1-RA | 213 | CG8261-PA | 1..210 | 17..226 | 1050 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:31:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma1-RC | 831 | CG8261-RC | 48..258 | 16..226 | 1055 | 100 | Plus |
Ggamma1-RB | 1084 | CG8261-RB | 301..511 | 16..226 | 1055 | 100 | Plus |
Ggamma1-RA | 2554 | CG8261-RA | 110..320 | 16..226 | 1055 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:31:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8902347..8902557 | 16..226 | 1055 | 100 | Plus |
Blast to na_te.dros performed 2014-11-27 13:31:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\ninja | 6644 | Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). | 1526..1564 | 32..72 | 101 | 75.6 | Plus |
BO18615.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:39:28 Download gff for
BO18615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma1-RB | 332..541 | 17..228 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:51:32 Download gff for
BO18615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma1-RA | 111..320 | 17..228 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:20:30 Download gff for
BO18615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma1-RA | 111..320 | 17..228 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:20:30 Download gff for
BO18615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8902348..8902557 | 17..228 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:51:32 Download gff for
BO18615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4789853..4790062 | 17..228 | 99 | | Plus |
BO18615.pep Sequence
Translation from 16 to 244
> BO18615.pep
MDVMSSSLQQQRVVVEQLRREAAIDRQTISESCAKMMKYITEHEQEDYLL
TGFTSQKVNPFREKSSCTVLASFLDH
BO18615.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 01:02:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma1-PC | 70 | CG8261-PC | 1..70 | 1..70 | 349 | 100 | Plus |
Ggamma1-PB | 70 | CG8261-PB | 1..70 | 1..70 | 349 | 100 | Plus |
Ggamma1-PA | 70 | CG8261-PA | 1..70 | 1..70 | 349 | 100 | Plus |
CG43324-PA | 66 | CG43324-PA | 1..66 | 4..70 | 209 | 61.2 | Plus |