Clone BO18620 Report

Search the DGRC for BO18620

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:186
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptCks30A-RA
Protein status:BO18620.pep: Imported from assembly
Sequenced Size:256

Clone Sequence Records

BO18620.complete Sequence

256 bp assembled on 2009-05-13

GenBank Submission: KX797365

> BO18620.complete
GAAGTTATCAGTCGACATGAGCAAGGACATTTACTACTCCGACAAGTACT
ACGATGAGCAGTTCGAGTACAGACATGTGGTTTTGCCAAAAGAGCTGGTA
AAAATGGTGCCCAAGACTCATCTGATGACGGAGGCCGAGTGGCGATCAAT
TGGCGTACAGCAGTCGCGCGGATGGATCCACTACATGATCCATAAGCCGG
AGCCCCACATCCTCCTGTTTCGGCGACCCAAAACGGATGCAAGCTTTCTA
GACCAT

BO18620.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Cks30A-RA 225 CG3738-PA 1..222 17..238 1110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Cks30A-RA 1147 CG3738-RA 293..514 17..238 1110 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:55:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9331179..9331348 69..238 850 100 Plus
2L 23513712 2L 9331055..9331110 17..72 280 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:55:10 has no hits.

BO18620.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:37:02 Download gff for BO18620.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 289..510 17..240 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:36 Download gff for BO18620.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 293..514 17..240 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:29:45 Download gff for BO18620.complete
Subject Subject Range Query Range Percent Splice Strand
Cks30A-RA 293..514 17..240 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:29:45 Download gff for BO18620.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9331183..9331348 73..240 98   Plus
2L 9331055..9331110 17..72 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:36 Download gff for BO18620.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9331055..9331110 17..72 100 -> Plus
arm_2L 9331183..9331348 73..240 98   Plus

BO18620.pep Sequence

Translation from 16 to 256

> BO18620.pep
MSKDIYYSDKYYDEQFEYRHVVLPKELVKMVPKTHLMTEAEWRSIGVQQS
RGWIHYMIHKPEPHILLFRRPKTDASFLDH

BO18620.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
Cks30A-PA 74 CG3738-PA 1..74 1..74 407 100 Plus
Cks85A-PC 96 CG9790-PC 6..76 5..75 290 66.2 Plus
Cks85A-PB 96 CG9790-PB 6..76 5..75 290 66.2 Plus
Cks85A-PA 96 CG9790-PA 6..76 5..75 290 66.2 Plus