Clone BO18635 Report

Search the DGRC for BO18635

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:186
Well:35
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO18635.pep: Imported from assembly
Sequenced Size:289

Clone Sequence Records

BO18635.complete Sequence

289 bp assembled on 2009-05-13

> BO18635.complete
GAAGTTATCAGTCGACATGGTCTATACGGTCCGTGGTCCCCATATAGTTT
ATGGTATTGGGGTTGGTCTGGTGAGTGCGACTGGAAAACGAAACATTTCC
GGCCTGGACATGAATAATAAAACAAAGCCAACGAGCAGGAAAGATAGTGT
GAAAAGAAAAGGGAGAAATTGTGGATACAAGAGCGACAAAGAAGGGCATC
GAAATAATCAATTTGATGTCGCAAAGTTCGTGGTCGCCCATGCACTGGAA
GAAAAAGAAAAGCCCAGAAGAGCAAGCTTTCTAGACCAT

BO18635.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 16:29:59 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 16:30:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21059263..21059518 271..16 1280 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:29:58 has no hits.

BO18635.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:36:56 Download gff for BO18635.complete
Subject Subject Range Query Range Percent Splice Strand
CG10987-RA 370..624 17..273 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:19:52 Download gff for BO18635.complete
Subject Subject Range Query Range Percent Splice Strand
X 21059261..21059517 17..273 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:19:52 Download gff for BO18635.complete
Subject Subject Range Query Range Percent Splice Strand
X 21059261..21059517 17..273 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:53:04 Download gff for BO18635.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20930288..20930544 17..273 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:53:04 Download gff for BO18635.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20930288..20930544 17..273 99   Minus

BO18635.pep Sequence

Translation from 16 to 289

> BO18635.pep
MVYTVRGPHIVYGIGVGLVSATGKRNISGLDMNNKTKPTSRKDSVKRKGR
NCGYKSDKEGHRNNQFDVAKFVVAHALEEKEKPRRASFLDH
Sequence BO18635.pep has no blast hits.