Clone BO18666 Report

Search the DGRC for BO18666

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:186
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG6982-RB
Protein status:BO18666.pep: Imported from assembly
Sequenced Size:643

Clone Sequence Records

BO18666.complete Sequence

643 bp assembled on 2009-05-13

GenBank Submission: KX797499

> BO18666.complete
GAAGTTATCAGTCGACATGGCGCCGACCACGACGATTGAGACCATCACAA
TCACGAGGCCGCTGAAGGTGATTGCATTTATCTGCGGCGTCATCGTGGTG
GCCCTCATGATTATGGCTCTGGCGTCCACAGATTGGTTAATGGCCTCAGA
CTGGCGGCAAGGTCTCTTTGTGCACTGCATCGAGGATGATTCGGTGCCGC
CGCTGCCATTCAATATCCAGGATCCGCCAGGATGCTACTGGACCCGCGAT
GTCGGCTACATTAAGGCCACAGCCGCTCTGTGCATCATCACGCTGATAAC
GGACGTCATTGCCACAGTACTGACAGGTCTGGGCCTCCGGACGCAGAATC
ATAATCTAAAGTATAAGTTCTATCGTATAGCAGTATTGGTGATGCTTGTA
TCCTTGCTGGCCGTATTGTCCGCCTTGATCGTATATCCAGTATGCTTTGC
CGGCGAACTAACCATGGCCAATCGACGAGTCTGGGAATTTGGCTGGGCCT
ATGGCGTCGGCTGGGGTGCGGCCATCTTTCTATTTGGGGCCGTTGTCCTG
CTGCTCTGCGACAAGGAGTCGGAGGAGATCTACTATAAGGAAAGGAAAAT
CGTACATGAAAACCAAATGCGCGCCGCAAGCTTTCTAGACCAT

BO18666.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG45049-RF 612 CG45049-PF 1..609 17..625 3045 100 Plus
CG45049-RE 822 CG45049-PE 211..819 17..625 3045 100 Plus
CG45049-RC 612 CG45049-PC 1..609 17..625 3045 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG45049-RF 1516 CG45049-RF 136..744 17..625 3045 100 Plus
CG45049-RE 3417 CG45049-RE 551..1159 17..625 3045 100 Plus
CG45049-RC 3708 CG45049-RC 842..1450 17..625 3045 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22729351..22729540 66..255 950 100 Plus
3R 32079331 3R 22729946..22730104 467..625 795 100 Plus
3R 32079331 3R 22729609..22729759 254..404 755 100 Plus
3R 32079331 3R 22729817..22729879 405..467 315 100 Plus
3R 32079331 3R 22729234..22729286 17..69 265 100 Plus
Blast to na_te.dros performed on 2014-11-28 01:05:33 has no hits.

BO18666.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:39:16 Download gff for BO18666.complete
Subject Subject Range Query Range Percent Splice Strand
CG17618-RB 817..1425 17..627 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:38:44 Download gff for BO18666.complete
Subject Subject Range Query Range Percent Splice Strand
CG17618-RC 842..1450 17..627 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:44:17 Download gff for BO18666.complete
Subject Subject Range Query Range Percent Splice Strand
CG45049-RC 842..1450 17..627 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:44:17 Download gff for BO18666.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22729947..22730104 468..627 98   Plus
3R 22729234..22729284 17..67 100 -> Plus
3R 22729353..22729539 68..254 100 -> Plus
3R 22729610..22729759 255..404 100 -> Plus
3R 22729817..22729879 405..467 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:38:44 Download gff for BO18666.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18554956..18555006 17..67 100 -> Plus
arm_3R 18555075..18555261 68..254 100 -> Plus
arm_3R 18555332..18555481 255..404 100 -> Plus
arm_3R 18555539..18555601 405..467 100 -> Plus
arm_3R 18555669..18555826 468..627 98   Plus

BO18666.pep Sequence

Translation from 16 to 643

> BO18666.pep
MAPTTTIETITITRPLKVIAFICGVIVVALMIMALASTDWLMASDWRQGL
FVHCIEDDSVPPLPFNIQDPPGCYWTRDVGYIKATAALCIITLITDVIAT
VLTGLGLRTQNHNLKYKFYRIAVLVMLVSLLAVLSALIVYPVCFAGELTM
ANRRVWEFGWAYGVGWGAAIFLFGAVVLLLCDKESEEIYYKERKIVHENQ
MRAASFLDH

BO18666.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 01:01:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG45049-PF 203 CG45049-PF 1..203 1..203 1061 100 Plus
CG45049-PC 203 CG45049-PC 1..203 1..203 1061 100 Plus
CG45049-PB 203 CG45049-PB 1..203 1..203 1061 100 Plus
CG45049-PE 273 CG45049-PE 71..273 1..203 1061 100 Plus
CG45049-PD 273 CG45049-PD 71..273 1..203 1061 100 Plus