Clone BO18727 Report

Search the DGRC for BO18727

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:187
Well:27
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO18727.pep: Imported from assembly
Sequenced Size:199

Clone Sequence Records

BO18727.complete Sequence

199 bp assembled on 2009-05-13

> BO18727.complete
GAAGTTATCAGTCGACATGACCGCCCCCTGCTTTGTGGGCGTCTCCTATC
TACTGCTGCTCCAGACCTACCGACTGCGCCTGGAGTACTGCCTGTGCACG
CTGCAGATCGCCCTTTACCTGACCGAGGTGTGGTATGCCATCGTCTTCGT
TTTCTCGCTGTGTCGTCCAGTAACTTATGATGCAAGCTTTCTAGACCAT

BO18727.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG11760-RB 450 CG11760-PB 282..447 16..181 830 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG11760-RB 1908 CG11760-RB 417..582 16..181 830 100 Plus
CG8116-RC 1826 CG8116-RC 1316..1481 16..181 830 100 Plus
CG8116-RB 2812 CG8116-RB 1321..1486 16..181 830 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8719829..8719994 16..181 830 100 Plus
Blast to na_te.dros performed on 2014-11-27 23:45:57 has no hits.

BO18727.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:36:56 Download gff for BO18727.complete
Subject Subject Range Query Range Percent Splice Strand
CG11760-RB 418..582 17..183 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:37:22 Download gff for BO18727.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RA 1322..1486 17..183 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:07:43 Download gff for BO18727.complete
Subject Subject Range Query Range Percent Splice Strand
CG8116-RB 1322..1486 17..183 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:07:43 Download gff for BO18727.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8719830..8719994 17..183 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:37:22 Download gff for BO18727.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4545552..4545716 17..183 98   Plus

BO18727.pep Sequence

Translation from 16 to 199

> BO18727.pep
MTAPCFVGVSYLLLLQTYRLRLEYCLCTLQIALYLTEVWYAIVFVFSLCR
PVTYDASFLDH

BO18727.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG11760-PB 149 CG11760-PB 95..149 1..55 294 100 Plus