BO18727.complete Sequence
199 bp assembled on 2009-05-13
> BO18727.complete
GAAGTTATCAGTCGACATGACCGCCCCCTGCTTTGTGGGCGTCTCCTATC
TACTGCTGCTCCAGACCTACCGACTGCGCCTGGAGTACTGCCTGTGCACG
CTGCAGATCGCCCTTTACCTGACCGAGGTGTGGTATGCCATCGTCTTCGT
TTTCTCGCTGTGTCGTCCAGTAACTTATGATGCAAGCTTTCTAGACCAT
BO18727.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:45:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11760-RB | 450 | CG11760-PB | 282..447 | 16..181 | 830 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:46:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11760-RB | 1908 | CG11760-RB | 417..582 | 16..181 | 830 | 100 | Plus |
CG8116-RC | 1826 | CG8116-RC | 1316..1481 | 16..181 | 830 | 100 | Plus |
CG8116-RB | 2812 | CG8116-RB | 1321..1486 | 16..181 | 830 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:45:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 8719829..8719994 | 16..181 | 830 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 23:45:57 has no hits.
BO18727.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:36:56 Download gff for
BO18727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11760-RB | 418..582 | 17..183 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:37:22 Download gff for
BO18727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8116-RA | 1322..1486 | 17..183 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:07:43 Download gff for
BO18727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8116-RB | 1322..1486 | 17..183 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:07:43 Download gff for
BO18727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8719830..8719994 | 17..183 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:37:22 Download gff for
BO18727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 4545552..4545716 | 17..183 | 98 | | Plus |
BO18727.pep Sequence
Translation from 16 to 199
> BO18727.pep
MTAPCFVGVSYLLLLQTYRLRLEYCLCTLQIALYLTEVWYAIVFVFSLCR
PVTYDASFLDH
BO18727.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:53:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11760-PB | 149 | CG11760-PB | 95..149 | 1..55 | 294 | 100 | Plus |