Clone BO18730 Report

Search the DGRC for BO18730

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:187
Well:30
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO18730.pep: Imported from assembly
Sequenced Size:259

Clone Sequence Records

BO18730.complete Sequence

259 bp assembled on 2009-05-13

> BO18730.complete
GAAGTTATCAGTCGACATGTTTGCACACGCAATTTGGCTTCGCCTTGCTC
CTTCCTCGACAAAGACCCGGGGACCAGGACGAGGACCTGGACCTGGAGCT
GGACTAGGACTTAAAACTGGAACTGGAACTGGACGTGGTCCTGAGGTGTG
GCCGAGAGTGAAAGAGGGCCAGGGCCAGGGATTATCACCAGCAGCAATAG
ACCGAGTCGAACAGATCGAAAAACAACAGAAAAAGTCCGCAGCAAGCTTT
CTAGACCAT

BO18730.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 16:40:03 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 16:40:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6607285..6607509 241..17 1125 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:40:02 has no hits.

BO18730.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:39:21 Download gff for BO18730.complete
Subject Subject Range Query Range Percent Splice Strand
CG15234-RA 1330..1548 23..243 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:23:50 Download gff for BO18730.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6607282..6607503 23..243 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:23:50 Download gff for BO18730.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6607282..6607503 23..243 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:57:29 Download gff for BO18730.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2494787..2495008 23..243 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:57:29 Download gff for BO18730.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2494787..2495008 23..243 99   Minus

BO18730.pep Sequence

Translation from 16 to 259

> BO18730.pep
MFAHAIWLRLAPSSTKTRGPGRGPGPGAGLGLKTGTGTGRGPEVWPRVKE
GQGQGLSPAAIDRVEQIEKQQKKSAASFLDH
Sequence BO18730.pep has no blast hits.