Clone BO18743 Report

Search the DGRC for BO18743

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:187
Well:43
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO18743.pep: Imported from assembly
Sequenced Size:274

Clone Sequence Records

BO18743.complete Sequence

274 bp assembled on 2009-05-13

> BO18743.complete
GAAGTTATCAGTCGACATGCAAATCGCTCAAATTGTGTATGCATTAAGTT
TTACTCCTCGCTTTGATTTTGTTATATTGTTGTACATACTAAAACTTATT
TGTTCTTCACCTTCTTCGGTAAGCCATTGTGTGTGTGAGTGTGTACGTCG
TCATGCGCTTGTCCTCGTTCTCTCTCTTTCGCGCACATGCAGCGCCGTGT
GCTCCCTTTTGTGTTTCTTTTCGTTTCGTCCTATTCCTCAATCGACTTTT
CATTTTGCAAGCTTTCTAGACCAT

BO18743.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-26 16:27:23 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
ctrip-RF 10759 CG42574-RF 187..289 16..118 515 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4806037..4806277 256..16 1205 100 Minus
Blast to na_te.dros performed 2014-11-26 16:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 6752..6855 133..32 101 56.7 Minus

BO18743.complete Sim4 Records

Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:19:32 Download gff for BO18743.complete
Subject Subject Range Query Range Percent Splice Strand
ctrip-RF 188..289 17..118 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:19:32 Download gff for BO18743.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4806035..4806276 17..258 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:01:21 Download gff for BO18743.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 631757..631998 17..258 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:01:21 Download gff for BO18743.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 631757..631998 17..258 99   Minus

BO18743.pep Sequence

Translation from 16 to 274

> BO18743.pep
MQIAQIVYALSFTPRFDFVILLYILKLICSSPSSVSHCVCECVRRHALVL
VLSLSRTCSAVCSLLCFFSFRPIPQSTFHFASFLDH
Sequence BO18743.pep has no blast hits.