BO18817.complete Sequence
316 bp assembled on 2009-05-13
GenBank Submission: KX798648
> BO18817.complete
GAAGTTATCAGTCGACATGAGCTTTGCTCTTAGATTGGGATCTTCAATCG
GGTGTTTTCACCGTACGATCTTAGGTCGTGACATAATTCAAAGGAAAAGT
CATGTGGTATCTTACCGCAATGGCCCCCCTCCCCATTCAAAGGCAACTAA
AATTGGTGCTTTAACTGTTGGAGGAGCTATGTGGTGGTGGGTAATCTGGC
ACTTATGGCATGAACCTGACCATATAACGGGGGAATTTGATTATCCTAAC
TCAAGGAAATGGAGCAACACAGAGTTGGGTGTTCCAAAGGATGGATTTGC
AAGCTTTCTAGACCAT
BO18817.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:07:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG40472-RC | 285 | CG40472-PC | 1..282 | 17..298 | 1410 | 100 | Plus |
CG40002-RB | 285 | CG40002-PB | 1..282 | 17..298 | 1410 | 100 | Plus |
CG40002-RA | 285 | CG40002-PA | 1..282 | 17..298 | 1410 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:07:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG40472-RC | 460 | CR40472-RC | 135..416 | 17..298 | 1410 | 100 | Plus |
CG40002-RB | 445 | CG40002-RB | 93..374 | 17..298 | 1410 | 100 | Plus |
CG40002-RA | 745 | CG40002-RA | 93..374 | 17..298 | 1410 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:07:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 24927407..24927531 | 106..230 | 625 | 100 | Plus |
3L | 28110227 | 3L | 24976489..24976613 | 106..230 | 625 | 100 | Plus |
3L | 28110227 | 3L | 24927264..24927353 | 17..106 | 450 | 100 | Plus |
3L | 28110227 | 3L | 24976346..24976435 | 17..106 | 450 | 100 | Plus |
3L | 28110227 | 3L | 24927597..24927666 | 229..298 | 350 | 100 | Plus |
3L | 28110227 | 3L | 24976678..24976747 | 229..298 | 350 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 01:07:15 has no hits.
BO18817.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:36:46 Download gff for
BO18817.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG40002-RA | 93..374 | 17..300 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:45:32 Download gff for
BO18817.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG40472-RC | 135..416 | 17..300 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:18:56 Download gff for
BO18817.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG40002-RA | 93..374 | 17..300 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:18:56 Download gff for
BO18817.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 24976346..24976434 | 17..105 | 100 | -> | Plus |
3L | 24976489..24976612 | 106..229 | 100 | -> | Plus |
3L | 24976679..24976747 | 230..300 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:45:32 Download gff for
BO18817.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3LHet | 459821..459944 | 106..229 | 100 | -> | Plus |
3LHet | 460011..460079 | 230..300 | 97 | | Plus |
3LHet | 459678..459766 | 17..105 | 100 | -> | Plus |
BO18817.pep Sequence
Translation from 16 to 316
> BO18817.pep
MSFALRLGSSIGCFHRTILGRDIIQRKSHVVSYRNGPPPHSKATKIGALT
VGGAMWWWVIWHLWHEPDHITGEFDYPNSRKWSNTELGVPKDGFASFLDH
BO18817.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:52:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG40472-PC | 94 | CR40472-PC | 1..94 | 1..94 | 535 | 100 | Plus |
CG40002-PB | 94 | CG40002-PB | 1..94 | 1..94 | 535 | 100 | Plus |
CG40002-PA | 94 | CG40002-PA | 1..94 | 1..94 | 535 | 100 | Plus |