Clone BO18817 Report

Search the DGRC for BO18817

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:17
Vector:pDNR-Dual
Associated Gene/TranscriptCG40002-RA
Protein status:BO18817.pep: Imported from assembly
Sequenced Size:316

Clone Sequence Records

BO18817.complete Sequence

316 bp assembled on 2009-05-13

GenBank Submission: KX798648

> BO18817.complete
GAAGTTATCAGTCGACATGAGCTTTGCTCTTAGATTGGGATCTTCAATCG
GGTGTTTTCACCGTACGATCTTAGGTCGTGACATAATTCAAAGGAAAAGT
CATGTGGTATCTTACCGCAATGGCCCCCCTCCCCATTCAAAGGCAACTAA
AATTGGTGCTTTAACTGTTGGAGGAGCTATGTGGTGGTGGGTAATCTGGC
ACTTATGGCATGAACCTGACCATATAACGGGGGAATTTGATTATCCTAAC
TCAAGGAAATGGAGCAACACAGAGTTGGGTGTTCCAAAGGATGGATTTGC
AAGCTTTCTAGACCAT

BO18817.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG40472-RC 285 CG40472-PC 1..282 17..298 1410 100 Plus
CG40002-RB 285 CG40002-PB 1..282 17..298 1410 100 Plus
CG40002-RA 285 CG40002-PA 1..282 17..298 1410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG40472-RC 460 CR40472-RC 135..416 17..298 1410 100 Plus
CG40002-RB 445 CG40002-RB 93..374 17..298 1410 100 Plus
CG40002-RA 745 CG40002-RA 93..374 17..298 1410 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 24927407..24927531 106..230 625 100 Plus
3L 28110227 3L 24976489..24976613 106..230 625 100 Plus
3L 28110227 3L 24927264..24927353 17..106 450 100 Plus
3L 28110227 3L 24976346..24976435 17..106 450 100 Plus
3L 28110227 3L 24927597..24927666 229..298 350 100 Plus
3L 28110227 3L 24976678..24976747 229..298 350 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:07:15 has no hits.

BO18817.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:36:46 Download gff for BO18817.complete
Subject Subject Range Query Range Percent Splice Strand
CG40002-RA 93..374 17..300 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:45:32 Download gff for BO18817.complete
Subject Subject Range Query Range Percent Splice Strand
CG40472-RC 135..416 17..300 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:18:56 Download gff for BO18817.complete
Subject Subject Range Query Range Percent Splice Strand
CG40002-RA 93..374 17..300 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:18:56 Download gff for BO18817.complete
Subject Subject Range Query Range Percent Splice Strand
3L 24976346..24976434 17..105 100 -> Plus
3L 24976489..24976612 106..229 100 -> Plus
3L 24976679..24976747 230..300 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:45:32 Download gff for BO18817.complete
Subject Subject Range Query Range Percent Splice Strand
3LHet 459821..459944 106..229 100 -> Plus
3LHet 460011..460079 230..300 97   Plus
3LHet 459678..459766 17..105 100 -> Plus

BO18817.pep Sequence

Translation from 16 to 316

> BO18817.pep
MSFALRLGSSIGCFHRTILGRDIIQRKSHVVSYRNGPPPHSKATKIGALT
VGGAMWWWVIWHLWHEPDHITGEFDYPNSRKWSNTELGVPKDGFASFLDH

BO18817.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:52:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG40472-PC 94 CR40472-PC 1..94 1..94 535 100 Plus
CG40002-PB 94 CG40002-PB 1..94 1..94 535 100 Plus
CG40002-PA 94 CG40002-PA 1..94 1..94 535 100 Plus