Clone BO18819 Report

Search the DGRC for BO18819

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptCG11686-RA
Protein status:BO18819.pep: Inserted from web
Sequenced Size:244

Clone Sequence Records

BO18819.complete Sequence

244 bp assembled on 2009-05-14

GenBank Submission: KX796129

> BO18819.complete
GAAGTTATCAGTCGACATGCCAAATCCACTGTGGTTCGTCTTCTGGCTGC
TGGTCTTCTGGTTCGTCTCCTTCTTCGTGGCATTCTTCTGCGCCTTTTTC
TACATCTGGGTCTACGCATTTGCCTCCTGCATTCCCGCCCTGACGGGCAT
ATCGGACATTCTGCTCCAGGGAGTCCAGTTCCCGTTCTACTGCGGGAAAG
CCATGTTAGAGGGCAAGCAAGCTTTTGCAAGCTTTCTAGACCAT

BO18819.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG11686-RB 213 CG11686-PB 1..210 17..226 1050 100 Plus
CG11686-RA 213 CG11686-PA 1..210 17..226 1050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG11686-RB 487 CG11686-RB 169..378 17..226 1050 100 Plus
CG11686-RA 419 CG11686-RA 101..310 17..226 1050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13261642..13261771 17..146 650 100 Plus
3R 32079331 3R 13262037..13262118 145..226 410 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:06:44 has no hits.

BO18819.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-14 12:40:53 Download gff for BO18819.complete
Subject Subject Range Query Range Percent Splice Strand
CG11686-RA 100..309 17..228 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:45:18 Download gff for BO18819.complete
Subject Subject Range Query Range Percent Splice Strand
CG11686-RA 101..310 17..228 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:18:45 Download gff for BO18819.complete
Subject Subject Range Query Range Percent Splice Strand
CG11686-RA 101..310 17..228 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:18:45 Download gff for BO18819.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13261642..13261770 17..145 100 -> Plus
3R 13262038..13262118 146..228 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:45:18 Download gff for BO18819.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9087364..9087492 17..145 100 -> Plus
arm_3R 9087760..9087840 146..228 97   Plus

BO18819.pep Sequence

Translation from 16 to 244

> BO18819.pep
MPNPLWFVFWLLVFWFVSFFVAFFCAFFYIWVYAFASCIPALTGISDILL
QGVQFPFYCGKAMLEGKQAFASFLDH

BO18819.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:13:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG11686-PB 70 CG11686-PB 1..70 1..70 393 100 Plus
CG11686-PA 70 CG11686-PA 1..70 1..70 393 100 Plus