BO18819.complete Sequence
244 bp assembled on 2009-05-14
GenBank Submission: KX796129
> BO18819.complete
GAAGTTATCAGTCGACATGCCAAATCCACTGTGGTTCGTCTTCTGGCTGC
TGGTCTTCTGGTTCGTCTCCTTCTTCGTGGCATTCTTCTGCGCCTTTTTC
TACATCTGGGTCTACGCATTTGCCTCCTGCATTCCCGCCCTGACGGGCAT
ATCGGACATTCTGCTCCAGGGAGTCCAGTTCCCGTTCTACTGCGGGAAAG
CCATGTTAGAGGGCAAGCAAGCTTTTGCAAGCTTTCTAGACCAT
BO18819.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:06:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11686-RB | 213 | CG11686-PB | 1..210 | 17..226 | 1050 | 100 | Plus |
CG11686-RA | 213 | CG11686-PA | 1..210 | 17..226 | 1050 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:06:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11686-RB | 487 | CG11686-RB | 169..378 | 17..226 | 1050 | 100 | Plus |
CG11686-RA | 419 | CG11686-RA | 101..310 | 17..226 | 1050 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:06:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 13261642..13261771 | 17..146 | 650 | 100 | Plus |
3R | 32079331 | 3R | 13262037..13262118 | 145..226 | 410 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 01:06:44 has no hits.
BO18819.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-14 12:40:53 Download gff for
BO18819.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11686-RA | 100..309 | 17..228 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:45:18 Download gff for
BO18819.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11686-RA | 101..310 | 17..228 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:18:45 Download gff for
BO18819.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11686-RA | 101..310 | 17..228 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:18:45 Download gff for
BO18819.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13261642..13261770 | 17..145 | 100 | -> | Plus |
3R | 13262038..13262118 | 146..228 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:45:18 Download gff for
BO18819.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 9087364..9087492 | 17..145 | 100 | -> | Plus |
arm_3R | 9087760..9087840 | 146..228 | 97 | | Plus |
BO18819.pep Sequence
Translation from 16 to 244
> BO18819.pep
MPNPLWFVFWLLVFWFVSFFVAFFCAFFYIWVYAFASCIPALTGISDILL
QGVQFPFYCGKAMLEGKQAFASFLDH
BO18819.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:13:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11686-PB | 70 | CG11686-PB | 1..70 | 1..70 | 393 | 100 | Plus |
CG11686-PA | 70 | CG11686-PA | 1..70 | 1..70 | 393 | 100 | Plus |