BO18821.complete Sequence
160 bp assembled on 2009-05-14
GenBank Submission: KX798554
> BO18821.complete
GAAGTTATCAGTCGACATGAAGTTCTTCCAAGCCGCCGCCCTTCTCTTGG
CCATGTTCGCTGCCCTCGCCAACGCCGAGCCCGTTCCCCAACCTGGAACC
GTGCTCATCCAGACCGACAACACCCAGTACATTCGTACTGGTGCAAGCTT
TCTAGACCAT
BO18821.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:34:08
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| IM4-RB | 129 | CG15231-PB | 1..126 | 17..142 | 630 | 100 | Plus |
| IM4-RA | 129 | CG15231-PA | 1..126 | 17..142 | 630 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:34:10
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| IM4-RB | 767 | CG15231-RB | 63..190 | 15..142 | 640 | 100 | Plus |
| IM4-RA | 418 | CG15231-RA | 63..190 | 15..142 | 640 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:34:06
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 20869182..20869259 | 92..15 | 390 | 100 | Minus |
| 2R | 25286936 | 2R | 20869073..20869122 | 142..93 | 250 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 07:34:07 has no hits.
BO18821.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-14 12:40:57 Download gff for
BO18821.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| IM4-RA | 65..190 | 17..144 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:25 Download gff for
BO18821.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| IM4-RA | 65..190 | 17..144 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:00:53 Download gff for
BO18821.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| IM4-RA | 65..190 | 17..144 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:00:53 Download gff for
BO18821.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 20869071..20869122 | 93..144 | 96 | <- | Minus |
| 2R | 20869182..20869257 | 17..92 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:25 Download gff for
BO18821.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 16756576..16756627 | 93..144 | 96 | <- | Minus |
| arm_2R | 16756687..16756762 | 17..92 | 100 | | Minus |
BO18821.pep Sequence
Translation from 16 to 160
> BO18821.pep
MKFFQAAALLLAMFAALANAEPVPQPGTVLIQTDNTQYIRTGASFLDH
BO18821.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:10:44
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| IM4-PB | 42 | CG15231-PB | 1..42 | 1..42 | 209 | 100 | Plus |
| IM4-PA | 42 | CG15231-PA | 1..42 | 1..42 | 209 | 100 | Plus |
