Clone BO18825 Report

Search the DGRC for BO18825

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptCG11501-RA
Protein status:BO18825.pep: Inserted from web
Sequenced Size:379

Clone Sequence Records

BO18825.complete Sequence

379 bp assembled on 2009-05-13

GenBank Submission: KX799442

> BO18825.complete
GAAGTTATCAGTCGACATGGCATCCCCAGTAGTCAGCCTGCTTCTCGTCG
GGATCTGCGCCCTGGCCTTTGTCCATGTGGCTCGGTCGGAATGCTGCACC
TCCCGGGAGCTGGTGGAATTCAAGATGGACAGAGGCGACTGCGAGGCTGT
GCGTGCAATCGAAAACTATCCCAACGGCTGCGAAGTGACGATCTGCGCCG
ATGGTGTTGCCCAGTTGGGCGCCTACTGCGGCCAGGGATCGTGCAACATC
TTCGGCTGCAACTGCGACGGCGGCTGTCTGAGCGGCGATTGGTCACAGGA
ATTTGTGAGGAGGAACCAGCAGTACGGAATCCAGATCATCAAAGTCACCA
GGCTGCCATTTGCAAGCTTTCTAGACCAT

BO18825.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:13:35
Subject Length Description Subject Range Query Range Score Percent Strand
Diedel-RA 348 CG11501-PA 1..345 17..361 1725 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:13:36
Subject Length Description Subject Range Query Range Score Percent Strand
Diedel-RA 416 CG11501-RA 27..372 16..361 1730 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29493878..29494223 16..361 1730 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:13:34 has no hits.

BO18825.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:37:30 Download gff for BO18825.complete
Subject Subject Range Query Range Percent Splice Strand
CG11501-RA 28..372 17..363 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:09:57 Download gff for BO18825.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel-RA 28..372 17..363 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:13:38 Download gff for BO18825.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel-RA 28..372 17..363 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:13:38 Download gff for BO18825.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29493879..29494223 17..363 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:09:57 Download gff for BO18825.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25319601..25319945 17..363 99   Plus

BO18825.pep Sequence

Translation from 16 to 379

> BO18825.pep
MASPVVSLLLVGICALAFVHVARSECCTSRELVEFKMDRGDCEAVRAIEN
YPNGCEVTICADGVAQLGAYCGQGSCNIFGCNCDGGCLSGDWSQEFVRRN
QQYGIQIIKVTRLPFASFLDH

BO18825.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:54:48
Subject Length Description Subject Range Query Range Score Percent Strand
Diedel-PA 115 CG11501-PA 1..115 1..115 625 100 Plus
Diedel3-PB 121 CG34329-PB 1..118 1..120 229 39.2 Plus
Diedel3-PA 121 CG34329-PA 1..118 1..120 229 39.2 Plus
Diedel2-PA 125 CG43228-PA 4..106 9..112 228 39.4 Plus