Clone BO18829 Report

Search the DGRC for BO18829

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:29
Vector:pDNR-Dual
Associated Gene/TranscriptCG17107-RA
Protein status:BO18829.pep: Inserted from web
Sequenced Size:322

Clone Sequence Records

BO18829.complete Sequence

322 bp assembled on 2009-05-14

GenBank Submission: KX798261

> BO18829.complete
GAAGTTATCAGTCGACATGAAGTTCCTGGCTATCTGCATTTTTCTAATCT
TCGCCCTGGTGGCCGTTCAGGCACATCCTGGTGGATTCGGCGGATTCGGT
GGAGGCGGTGGTGGCGGTGGTCGCGGTGGAGGCGGTGGAGGCGGTGGAGT
CGGTGGAGTCGGCGGTTCGAACGCAGTTGCCAACGCGAATGCCGCTGCAA
CCGCCGACAGCAGAGGAGGCGGCCCAGCTTCCGCCTCGGCCTCGGCCACT
GCAACCGCCAACGCCAGCTCCGGAGGAGGTGGAGGTGGACATGGCAGACA
TGGAGCAAGCTTTCTAGACCAT

BO18829.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG17107-RC 291 CG17107-PC 1..288 17..304 1440 100 Plus
CG17107-RB 291 CG17107-PB 1..288 17..304 1440 100 Plus
CG17107-RA 291 CG17107-PA 1..288 17..304 1440 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG17107-RC 563 CG17107-RC 26..313 17..304 1440 100 Plus
CG17107-RB 482 CG17107-RB 90..377 17..304 1440 100 Plus
CG17107-RA 418 CG17107-RA 26..313 17..304 1440 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10681991..10682278 17..304 1440 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:46:40 has no hits.

BO18829.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-14 12:40:56 Download gff for BO18829.complete
Subject Subject Range Query Range Percent Splice Strand
CG17107-RA 19..306 17..306 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:33:41 Download gff for BO18829.complete
Subject Subject Range Query Range Percent Splice Strand
CG17107-RA 26..313 17..306 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:09:16 Download gff for BO18829.complete
Subject Subject Range Query Range Percent Splice Strand
CG17107-RA 26..313 17..306 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:09:16 Download gff for BO18829.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10681991..10682278 17..306 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:33:41 Download gff for BO18829.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10681991..10682278 17..306 99   Plus

BO18829.pep Sequence

Translation from 16 to 322

> BO18829.pep
MKFLAICIFLIFALVAVQAHPGGFGGFGGGGGGGGRGGGGGGGGVGGVGG
SNAVANANAAATADSRGGGPASASASATATANASSGGGGGGHGRHGASFL
DH

BO18829.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:13:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG17107-PC 96 CG17107-PC 1..96 1..96 506 100 Plus
CG17107-PB 96 CG17107-PB 1..96 1..96 506 100 Plus
CG17107-PA 96 CG17107-PA 1..96 1..96 506 100 Plus
CG17105-PB 103 CG17105-PB 1..99 1..91 175 43.4 Plus
CG17105-PA 103 CG17105-PA 1..99 1..91 175 43.4 Plus