Clone BO18834 Report

Search the DGRC for BO18834

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptRpS20-RA
Protein status:BO18834.pep: Imported from assembly
Sequenced Size:394

Clone Sequence Records

BO18834.complete Sequence

394 bp assembled on 2009-05-13

GenBank Submission: KX799643

> BO18834.complete
GAAGTTATCAGTCGACATGGCTGCTGCACCCAAGGATATTGAGAAGCCCC
ATGTCGGCGATTCTGCCTCTGTGCACCGCATCCGCATCACCCTGACATCC
AGGAACGTGCGTTCGCTGGAGAATGTGTGCCGCGACCTGATCAACGGTGC
AAAGAACCAGAACTTGCGCGTCAAGGGCCCCGTGCGCATGCCGACCAAGA
CCCTTCGCATCACCACCCGTAAGACTCCTTGTGGTGAGGGTTCCAAGACC
TGGGATCGCTTCCAGATGAGAATCCACAAGCGCATCATCGACTTGCACTC
GCCCTCTGAGATCGTCAAGAAGATTACCTCCATCAACATCGAGCCCGGCG
TAGAGGTTGAGGTCACCATCGCCAACGCAAGCTTTCTAGACCAT

BO18834.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
RpS20-RA 363 CG15693-PA 1..360 17..376 1800 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
RpS20-RA 564 CG15693-RA 91..450 17..376 1800 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20822417..20822574 19..176 790 100 Plus
3R 32079331 3R 20823126..20823242 260..376 585 100 Plus
3R 32079331 3R 20822800..20822891 174..265 460 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:33:21 has no hits.

BO18834.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:37:41 Download gff for BO18834.complete
Subject Subject Range Query Range Percent Splice Strand
RpS20-RA 93..452 17..378 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:56:48 Download gff for BO18834.complete
Subject Subject Range Query Range Percent Splice Strand
RpS20-RA 91..450 17..378 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:27:45 Download gff for BO18834.complete
Subject Subject Range Query Range Percent Splice Strand
RpS20-RA 91..450 17..378 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:27:45 Download gff for BO18834.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20822416..20822573 17..175 99 -> Plus
3R 20822802..20822891 176..265 100 -> Plus
3R 20823132..20823242 266..378 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:56:48 Download gff for BO18834.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16648138..16648295 17..175 99 -> Plus
arm_3R 16648524..16648613 176..265 100 -> Plus
arm_3R 16648854..16648964 266..378 98   Plus

BO18834.pep Sequence

Translation from 16 to 394

> BO18834.pep
MAAAPKDIEKPHVGDSASVHRIRITLTSRNVRSLENVCRDLINGAKNQNL
RVKGPVRMPTKTLRITTRKTPCGEGSKTWDRFQMRIHKRIIDLHSPSEIV
KKITSINIEPGVEVEVTIANASFLDH

BO18834.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
RpS20-PA 120 CG15693-PA 1..120 1..120 616 100 Plus