Clone BO18841 Report

Search the DGRC for BO18841

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptCG33169-RA
Protein status:BO18841.pep: Inserted from web
Sequenced Size:208

Clone Sequence Records

BO18841.complete Sequence

208 bp assembled on 2009-05-14

GenBank Submission: KX799185

> BO18841.complete
GAAGTTATCAGTCGACATGCGCCAGCTGAAGGGAAAGGTGAAGGAGACGC
GCAAACAGAAGAAGGAGCGCAAGCTGGACAACCTGGAGACCCAGGCGAAG
ATCCGCACCGTGGTGCTGCCGGCGCTCGGCGTTTTGGCGGTCTTTCTGGT
GCTGTTCGTCTACTTGAAGACCCGCCCCGCGGTCTTGGCCGCAAGCTTTC
TAGACCAT

BO18841.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG33169-RC 177 CG33169-PC 1..174 17..190 870 100 Plus
CG33169-RA 177 CG33169-PA 1..174 17..190 870 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG33169-RC 396 CG33169-RC 120..293 17..190 870 100 Plus
CG33169-RA 633 CG33169-RA 120..293 17..190 870 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:15:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22863983..22864156 17..190 870 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:15:28 has no hits.

BO18841.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-14 12:40:55 Download gff for BO18841.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RA 120..293 17..192 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:15 Download gff for BO18841.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RA 120..293 17..192 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:21:55 Download gff for BO18841.complete
Subject Subject Range Query Range Percent Splice Strand
CG33169-RA 120..293 17..192 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:21:55 Download gff for BO18841.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22863983..22864156 17..192 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:15 Download gff for BO18841.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22857083..22857256 17..192 98   Plus

BO18841.pep Sequence

Translation from 16 to 208

> BO18841.pep
MRQLKGKVKETRKQKKERKLDNLETQAKIRTVVLPALGVLAVFLVLFVYL
KTRPAVLAASFLDH

BO18841.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:24:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG33169-PC 58 CG33169-PC 1..58 1..58 278 100 Plus
CG33169-PA 58 CG33169-PA 1..58 1..58 278 100 Plus