BO18841.complete Sequence
208 bp assembled on 2009-05-14
GenBank Submission: KX799185
> BO18841.complete
GAAGTTATCAGTCGACATGCGCCAGCTGAAGGGAAAGGTGAAGGAGACGC
GCAAACAGAAGAAGGAGCGCAAGCTGGACAACCTGGAGACCCAGGCGAAG
ATCCGCACCGTGGTGCTGCCGGCGCTCGGCGTTTTGGCGGTCTTTCTGGT
GCTGTTCGTCTACTTGAAGACCCGCCCCGCGGTCTTGGCCGCAAGCTTTC
TAGACCAT
BO18841.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:15:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33169-RC | 177 | CG33169-PC | 1..174 | 17..190 | 870 | 100 | Plus |
CG33169-RA | 177 | CG33169-PA | 1..174 | 17..190 | 870 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:15:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33169-RC | 396 | CG33169-RC | 120..293 | 17..190 | 870 | 100 | Plus |
CG33169-RA | 633 | CG33169-RA | 120..293 | 17..190 | 870 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:15:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 22863983..22864156 | 17..190 | 870 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 01:15:28 has no hits.
BO18841.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-14 12:40:55 Download gff for
BO18841.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33169-RA | 120..293 | 17..192 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:15 Download gff for
BO18841.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33169-RA | 120..293 | 17..192 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:21:55 Download gff for
BO18841.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33169-RA | 120..293 | 17..192 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:21:55 Download gff for
BO18841.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22863983..22864156 | 17..192 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:15 Download gff for
BO18841.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 22857083..22857256 | 17..192 | 98 | | Plus |
BO18841.pep Sequence
Translation from 16 to 208
> BO18841.pep
MRQLKGKVKETRKQKKERKLDNLETQAKIRTVVLPALGVLAVFLVLFVYL
KTRPAVLAASFLDH
BO18841.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:24:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33169-PC | 58 | CG33169-PC | 1..58 | 1..58 | 278 | 100 | Plus |
CG33169-PA | 58 | CG33169-PA | 1..58 | 1..58 | 278 | 100 | Plus |