BO18844.complete Sequence
283 bp assembled on 2009-05-13
GenBank Submission: KX794966
> BO18844.complete
GAAGTTATCAGTCGACATGGAGAACGACGCCGGTGAGAATGTTGATCTGT
ACGTGCCCCGCAAATGCTCGGCGTCCAACAGGATCATCCACGCCAAGGAT
CACGCCTCCGTGCAGCTGAGCATCGTGGATGTGGACCCCGAGACCGGTCG
CCAGACCGACGGTTCCAAGACCTACGCCATCTGCGGCGAGATCCGTCGCA
TGGGCGAGTCCGACGACTGCATCGTGCGTCTGGCCAAGAAGGACGGCATC
ATTACCAAGAACTTCGCAAGCTTTCTAGACCAT
BO18844.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:51:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS21-RD | 252 | CG2986-PD | 1..249 | 17..265 | 1245 | 100 | Plus |
RpS21-RB | 252 | CG2986-PB | 1..249 | 17..265 | 1245 | 100 | Plus |
RpS21-RA | 252 | CG2986-PA | 1..249 | 17..265 | 1245 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:51:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS21-RD | 415 | CG2986-RD | 99..347 | 17..265 | 1245 | 100 | Plus |
RpS21-RB | 619 | CG2986-RB | 75..323 | 17..265 | 1245 | 100 | Plus |
RpS21-RA | 391 | CG2986-RA | 75..323 | 17..265 | 1245 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:51:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2856376..2856569 | 66..259 | 970 | 100 | Plus |
2L | 23513712 | 2L | 2856256..2856305 | 17..66 | 250 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 20:51:48 has no hits.
BO18844.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:37:31 Download gff for
BO18844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
oho23B-RB | 116..364 | 17..267 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:12:19 Download gff for
BO18844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS21-RA | 75..323 | 17..267 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:29:51 Download gff for
BO18844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS21-RA | 75..323 | 17..267 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:29:51 Download gff for
BO18844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2856256..2856305 | 17..66 | 100 | -> | Plus |
2L | 2856377..2856575 | 67..264 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:12:19 Download gff for
BO18844.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2856256..2856305 | 17..66 | 100 | -> | Plus |
arm_2L | 2856377..2856575 | 67..264 | 98 | | Plus |
BO18844.pep Sequence
Translation from 16 to 283
> BO18844.pep
MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGS
KTYAICGEIRRMGESDDCIVRLAKKDGIITKNFASFLDH
BO18844.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:54:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS21-PD | 83 | CG2986-PD | 1..83 | 1..83 | 432 | 100 | Plus |
RpS21-PB | 83 | CG2986-PB | 1..83 | 1..83 | 432 | 100 | Plus |
RpS21-PA | 83 | CG2986-PA | 1..83 | 1..83 | 432 | 100 | Plus |
RpS21-PF | 83 | CG2986-PF | 1..83 | 1..83 | 432 | 100 | Plus |
RpS21-PE | 81 | CG2986-PE | 1..81 | 1..81 | 420 | 100 | Plus |