Clone BO18844 Report

Search the DGRC for BO18844

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:44
Vector:pDNR-Dual
Associated Gene/Transcriptoho23B-RA
Protein status:BO18844.pep: Imported from assembly
Sequenced Size:283

Clone Sequence Records

BO18844.complete Sequence

283 bp assembled on 2009-05-13

GenBank Submission: KX794966

> BO18844.complete
GAAGTTATCAGTCGACATGGAGAACGACGCCGGTGAGAATGTTGATCTGT
ACGTGCCCCGCAAATGCTCGGCGTCCAACAGGATCATCCACGCCAAGGAT
CACGCCTCCGTGCAGCTGAGCATCGTGGATGTGGACCCCGAGACCGGTCG
CCAGACCGACGGTTCCAAGACCTACGCCATCTGCGGCGAGATCCGTCGCA
TGGGCGAGTCCGACGACTGCATCGTGCGTCTGGCCAAGAAGGACGGCATC
ATTACCAAGAACTTCGCAAGCTTTCTAGACCAT

BO18844.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:51:49
Subject Length Description Subject Range Query Range Score Percent Strand
RpS21-RD 252 CG2986-PD 1..249 17..265 1245 100 Plus
RpS21-RB 252 CG2986-PB 1..249 17..265 1245 100 Plus
RpS21-RA 252 CG2986-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
RpS21-RD 415 CG2986-RD 99..347 17..265 1245 100 Plus
RpS21-RB 619 CG2986-RB 75..323 17..265 1245 100 Plus
RpS21-RA 391 CG2986-RA 75..323 17..265 1245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2856376..2856569 66..259 970 100 Plus
2L 23513712 2L 2856256..2856305 17..66 250 100 Plus
Blast to na_te.dros performed on 2014-11-27 20:51:48 has no hits.

BO18844.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:37:31 Download gff for BO18844.complete
Subject Subject Range Query Range Percent Splice Strand
oho23B-RB 116..364 17..267 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:12:19 Download gff for BO18844.complete
Subject Subject Range Query Range Percent Splice Strand
RpS21-RA 75..323 17..267 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:29:51 Download gff for BO18844.complete
Subject Subject Range Query Range Percent Splice Strand
RpS21-RA 75..323 17..267 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:29:51 Download gff for BO18844.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2856256..2856305 17..66 100 -> Plus
2L 2856377..2856575 67..264 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:12:19 Download gff for BO18844.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2856256..2856305 17..66 100 -> Plus
arm_2L 2856377..2856575 67..264 98   Plus

BO18844.pep Sequence

Translation from 16 to 283

> BO18844.pep
MENDAGENVDLYVPRKCSASNRIIHAKDHASVQLSIVDVDPETGRQTDGS
KTYAICGEIRRMGESDDCIVRLAKKDGIITKNFASFLDH

BO18844.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
RpS21-PD 83 CG2986-PD 1..83 1..83 432 100 Plus
RpS21-PB 83 CG2986-PB 1..83 1..83 432 100 Plus
RpS21-PA 83 CG2986-PA 1..83 1..83 432 100 Plus
RpS21-PF 83 CG2986-PF 1..83 1..83 432 100 Plus
RpS21-PE 81 CG2986-PE 1..81 1..81 420 100 Plus