BO18846.complete Sequence
151 bp assembled on 2009-05-14
GenBank Submission: KX796874
> BO18846.complete
GAAGTTATCAGTCGACATGAAATTCCTATCACTCGCCTTCGTTTTGGGTC
TGCTGGCTCTGGCCAACGCCACTCCCCTGAATCCTGGCAATGTCATCATC
AATGGCGATTGCCGCGTCTGCAATGTGAGGGCCGCAAGCTTTCTAGACCA
T
BO18846.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:35:19
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| IM3-RB | 120 | CG16844-PB | 1..117 | 17..133 | 585 | 100 | Plus |
| IM3-RA | 120 | CG16844-PA | 1..117 | 17..133 | 585 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:35:20
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| IM3-RB | 769 | CG16844-RB | 289..407 | 15..133 | 595 | 100 | Plus |
| IM3-RA | 301 | CG16844-RA | 65..183 | 15..133 | 595 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:35:17
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 18388307..18388372 | 68..133 | 330 | 100 | Plus |
| 2R | 25286936 | 2R | 18388183..18388236 | 15..68 | 270 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 22:35:18 has no hits.
BO18846.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-14 12:40:58 Download gff for
BO18846.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| IM3-RA | 66..182 | 17..135 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:02:52 Download gff for
BO18846.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| IM3-RA | 67..183 | 17..135 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:05:05 Download gff for
BO18846.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| IM3-RA | 67..183 | 17..135 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:05:05 Download gff for
BO18846.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 18388185..18388236 | 17..68 | 100 | -> | Plus |
| 2R | 18388308..18388372 | 69..135 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:02:52 Download gff for
BO18846.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 14275690..14275741 | 17..68 | 100 | -> | Plus |
| arm_2R | 14275813..14275877 | 69..135 | 97 | | Plus |
BO18846.pep Sequence
Translation from 16 to 151
> BO18846.pep
MKFLSLAFVLGLLALANATPLNPGNVIINGDCRVCNVRAASFLDH
BO18846.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:36:44
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| IM3-PB | 39 | CG16844-PB | 1..39 | 1..39 | 199 | 100 | Plus |
| IM3-PA | 39 | CG16844-PA | 1..39 | 1..39 | 199 | 100 | Plus |
| CG15068-PA | 40 | CG15068-PA | 1..38 | 1..38 | 157 | 73.7 | Plus |
| CG15065-PA | 40 | CG15065-PA | 1..38 | 1..38 | 154 | 76.3 | Plus |
| IM1-PA | 45 | CG18108-PA | 1..41 | 1..37 | 140 | 75.6 | Plus |
