Clone BO18847 Report

Search the DGRC for BO18847

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG3176-RA
Protein status:BO18847.pep: Imported from assembly
Sequenced Size:397

Clone Sequence Records

BO18847.complete Sequence

397 bp assembled on 2009-05-13

GenBank Submission: KX798139

> BO18847.complete
GAAGTTATCAGTCGACATGCTTTTCGATGGCGAAACCGGCAATGGGCAAG
GTCAGGGCCAGAATACCCTGAATCCATTGGGGCCAGGCCAGGAGGAGCCC
GCCCTATGCGAGCAGTACTATCTGCTGGGCGATGGTTCCATCATTCTGCG
CAACCATTCCATCGACTTGTCGAATCCGCCCCTGAAATCGCGCTGCTGCC
AGCTCCCAACACTCATCCACGACATATGCGTCAACTGCGTGATGGATCTC
TGCGAGGAGTGTGGCTACTCCTGCGGCGAGTGCGCCAAGTTTATTTGCCG
CAACTGCGTGACTTTATTTGGTAATCGAATTGAAGAAGAGGAGGATCCGC
TGTGCGAGCACTGCCAGATGTTCCTCAGCGCAAGCTTTCTAGACCAT

BO18847.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:17:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG3176-RD 366 CG3176-PD 1..363 17..379 1815 100 Plus
CG3176-RA 366 CG3176-PA 1..363 17..379 1815 100 Plus
CG32817-RB 366 CG32817-PB 1..363 17..379 1770 99.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG3176-RD 627 CG3176-RD 75..437 17..379 1815 100 Plus
CG3176-RA 517 CG3176-RA 75..437 17..379 1815 100 Plus
CG32817-RB 580 CG32817-RB 142..504 17..379 1770 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:17:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 482132..482433 17..318 1510 100 Plus
X 23542271 X 479644..479945 17..318 1480 99.3 Plus
X 23542271 X 477621..477931 17..318 1025 89.4 Plus
X 23542271 X 482518..482578 319..379 305 100 Plus
X 23542271 X 480030..480090 319..379 290 98.4 Plus
X 23542271 X 478013..478073 319..379 245 93.4 Plus
Blast to na_te.dros performed on 2014-11-27 13:17:30 has no hits.

BO18847.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:37:20 Download gff for BO18847.complete
Subject Subject Range Query Range Percent Splice Strand
CG3176-RA 153..515 17..381 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:28:38 Download gff for BO18847.complete
Subject Subject Range Query Range Percent Splice Strand
CG3176-RA 75..437 17..381 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:15:03 Download gff for BO18847.complete
Subject Subject Range Query Range Percent Splice Strand
CG3176-RA 75..437 17..381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:15:03 Download gff for BO18847.complete
Subject Subject Range Query Range Percent Splice Strand
X 482132..482433 17..318 100 -> Plus
X 482518..482578 319..381 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:28:38 Download gff for BO18847.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 376165..376466 17..318 100 -> Plus
arm_X 376551..376611 319..381 96   Plus

BO18847.pep Sequence

Translation from 16 to 397

> BO18847.pep
MLFDGETGNGQGQGQNTLNPLGPGQEEPALCEQYYLLGDGSIILRNHSID
LSNPPLKSRCCQLPTLIHDICVNCVMDLCEECGYSCGECAKFICRNCVTL
FGNRIEEEEDPLCEHCQMFLSASFLDH

BO18847.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG3176-PD 121 CG3176-PD 1..121 1..121 683 100 Plus
CG3176-PA 121 CG3176-PA 1..121 1..121 683 100 Plus
CG32817-PB 121 CG32817-PB 1..121 1..121 664 97.5 Plus
CG32817-PC 121 CG32817-PC 1..121 1..121 664 97.5 Plus
CG32817-PA 121 CG32817-PA 1..121 1..121 664 97.5 Plus