BO18847.complete Sequence
397 bp assembled on 2009-05-13
GenBank Submission: KX798139
> BO18847.complete
GAAGTTATCAGTCGACATGCTTTTCGATGGCGAAACCGGCAATGGGCAAG
GTCAGGGCCAGAATACCCTGAATCCATTGGGGCCAGGCCAGGAGGAGCCC
GCCCTATGCGAGCAGTACTATCTGCTGGGCGATGGTTCCATCATTCTGCG
CAACCATTCCATCGACTTGTCGAATCCGCCCCTGAAATCGCGCTGCTGCC
AGCTCCCAACACTCATCCACGACATATGCGTCAACTGCGTGATGGATCTC
TGCGAGGAGTGTGGCTACTCCTGCGGCGAGTGCGCCAAGTTTATTTGCCG
CAACTGCGTGACTTTATTTGGTAATCGAATTGAAGAAGAGGAGGATCCGC
TGTGCGAGCACTGCCAGATGTTCCTCAGCGCAAGCTTTCTAGACCAT
BO18847.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:17:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3176-RD | 366 | CG3176-PD | 1..363 | 17..379 | 1815 | 100 | Plus |
CG3176-RA | 366 | CG3176-PA | 1..363 | 17..379 | 1815 | 100 | Plus |
CG32817-RB | 366 | CG32817-PB | 1..363 | 17..379 | 1770 | 99.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:17:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3176-RD | 627 | CG3176-RD | 75..437 | 17..379 | 1815 | 100 | Plus |
CG3176-RA | 517 | CG3176-RA | 75..437 | 17..379 | 1815 | 100 | Plus |
CG32817-RB | 580 | CG32817-RB | 142..504 | 17..379 | 1770 | 99.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:17:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 482132..482433 | 17..318 | 1510 | 100 | Plus |
X | 23542271 | X | 479644..479945 | 17..318 | 1480 | 99.3 | Plus |
X | 23542271 | X | 477621..477931 | 17..318 | 1025 | 89.4 | Plus |
X | 23542271 | X | 482518..482578 | 319..379 | 305 | 100 | Plus |
X | 23542271 | X | 480030..480090 | 319..379 | 290 | 98.4 | Plus |
X | 23542271 | X | 478013..478073 | 319..379 | 245 | 93.4 | Plus |
Blast to na_te.dros performed on 2014-11-27 13:17:30 has no hits.
BO18847.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:37:20 Download gff for
BO18847.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3176-RA | 153..515 | 17..381 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:28:38 Download gff for
BO18847.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3176-RA | 75..437 | 17..381 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:15:03 Download gff for
BO18847.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3176-RA | 75..437 | 17..381 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:15:03 Download gff for
BO18847.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 482132..482433 | 17..318 | 100 | -> | Plus |
X | 482518..482578 | 319..381 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:28:38 Download gff for
BO18847.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 376165..376466 | 17..318 | 100 | -> | Plus |
arm_X | 376551..376611 | 319..381 | 96 | | Plus |
BO18847.pep Sequence
Translation from 16 to 397
> BO18847.pep
MLFDGETGNGQGQGQNTLNPLGPGQEEPALCEQYYLLGDGSIILRNHSID
LSNPPLKSRCCQLPTLIHDICVNCVMDLCEECGYSCGECAKFICRNCVTL
FGNRIEEEEDPLCEHCQMFLSASFLDH
BO18847.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:54:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3176-PD | 121 | CG3176-PD | 1..121 | 1..121 | 683 | 100 | Plus |
CG3176-PA | 121 | CG3176-PA | 1..121 | 1..121 | 683 | 100 | Plus |
CG32817-PB | 121 | CG32817-PB | 1..121 | 1..121 | 664 | 97.5 | Plus |
CG32817-PC | 121 | CG32817-PC | 1..121 | 1..121 | 664 | 97.5 | Plus |
CG32817-PA | 121 | CG32817-PA | 1..121 | 1..121 | 664 | 97.5 | Plus |