Clone BO18848 Report

Search the DGRC for BO18848

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptCG32726-RA
Protein status:BO18848.pep: Inserted from web
Sequenced Size:214

Clone Sequence Records

BO18848.complete Sequence

214 bp assembled on 2009-05-14

GenBank Submission: KX799853

> BO18848.complete
GAAGTTATCAGTCGACATGCGTTTCTGTCTACTGTTCCTTTTGGCCATGA
GCTGCTGTCTGCTGCAATTCTCCGTGGCTGGAGTGAATTTGGTGCGCGGA
CTGGAGGCTGCCGGTCATCATCGCAACTTCACCGGCTCACCACCACCGCG
TGGTGCTCCTCCACCACCTCGGACCACCACCGCCAGTTCTTCGGGTGCAA
GCTTTCTAGACCAT

BO18848.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG32726-RB 183 CG32726-PB 1..180 17..196 900 100 Plus
CG32726-RA 183 CG32726-PA 1..180 17..196 900 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG32726-RB 317 CG32726-RB 18..197 17..196 900 100 Plus
CG32726-RA 458 CG32726-RA 18..197 17..196 900 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7425481..7425613 196..64 665 100 Minus
X 23542271 X 7425679..7425726 64..17 240 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:01:15 has no hits.

BO18848.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-14 12:40:54 Download gff for BO18848.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 18..197 17..198 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:42:24 Download gff for BO18848.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 18..197 17..198 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:16:30 Download gff for BO18848.complete
Subject Subject Range Query Range Percent Splice Strand
CG32726-RA 18..197 17..198 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:16:30 Download gff for BO18848.complete
Subject Subject Range Query Range Percent Splice Strand
X 7425479..7425612 65..198 98 <- Minus
X 7425679..7425726 17..64 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:42:24 Download gff for BO18848.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7319512..7319645 65..198 98 <- Minus
arm_X 7319712..7319759 17..64 100   Minus

BO18848.pep Sequence

Translation from 16 to 214

> BO18848.pep
MRFCLLFLLAMSCCLLQFSVAGVNLVRGLEAAGHHRNFTGSPPPRGAPPP
PRTTTASSSGASFLDH

BO18848.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG32726-PB 60 CG32726-PB 1..60 1..60 321 100 Plus
CG32726-PA 60 CG32726-PA 1..60 1..60 321 100 Plus