BO18848.complete Sequence
214 bp assembled on 2009-05-14
GenBank Submission: KX799853
> BO18848.complete
GAAGTTATCAGTCGACATGCGTTTCTGTCTACTGTTCCTTTTGGCCATGA
GCTGCTGTCTGCTGCAATTCTCCGTGGCTGGAGTGAATTTGGTGCGCGGA
CTGGAGGCTGCCGGTCATCATCGCAACTTCACCGGCTCACCACCACCGCG
TGGTGCTCCTCCACCACCTCGGACCACCACCGCCAGTTCTTCGGGTGCAA
GCTTTCTAGACCAT
BO18848.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:01:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32726-RB | 183 | CG32726-PB | 1..180 | 17..196 | 900 | 100 | Plus |
CG32726-RA | 183 | CG32726-PA | 1..180 | 17..196 | 900 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:01:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32726-RB | 317 | CG32726-RB | 18..197 | 17..196 | 900 | 100 | Plus |
CG32726-RA | 458 | CG32726-RA | 18..197 | 17..196 | 900 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:01:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7425481..7425613 | 196..64 | 665 | 100 | Minus |
X | 23542271 | X | 7425679..7425726 | 64..17 | 240 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 01:01:15 has no hits.
BO18848.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-14 12:40:54 Download gff for
BO18848.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32726-RA | 18..197 | 17..198 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:42:24 Download gff for
BO18848.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32726-RA | 18..197 | 17..198 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:16:30 Download gff for
BO18848.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32726-RA | 18..197 | 17..198 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:16:30 Download gff for
BO18848.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7425479..7425612 | 65..198 | 98 | <- | Minus |
X | 7425679..7425726 | 17..64 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:42:24 Download gff for
BO18848.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 7319512..7319645 | 65..198 | 98 | <- | Minus |
arm_X | 7319712..7319759 | 17..64 | 100 | | Minus |
BO18848.pep Sequence
Translation from 16 to 214
> BO18848.pep
MRFCLLFLLAMSCCLLQFSVAGVNLVRGLEAAGHHRNFTGSPPPRGAPPP
PRTTTASSSGASFLDH
BO18848.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:36:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32726-PB | 60 | CG32726-PB | 1..60 | 1..60 | 321 | 100 | Plus |
CG32726-PA | 60 | CG32726-PA | 1..60 | 1..60 | 321 | 100 | Plus |