Clone BO18856 Report

Search the DGRC for BO18856

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:188
Well:56
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO18856.pep: Imported from assembly
Sequenced Size:274

Clone Sequence Records

BO18856.complete Sequence

274 bp assembled on 2009-05-13

> BO18856.complete
GAAGTTATCAGTCGACATGGTGCGCTTTGCGGTGCACTTGTTACCCTCCT
TCTTGAATGGGGCGGGGCAGCTCTTGGCCGAAACAGTCATGGCGATGAGG
GCCAAGATGAAGATGCCACGAACAGCTGTTTGGTTTTTAGCCCTTAACCC
GCTGCTTATGCCGGGCGGCTTTTTCCTCCCAGTTGATGCGGTGGCAACCT
CAGGCATTGACTTTGGTAAAATTGTGGCACGCCAAGCACATTTTGAAGCT
CATCAGGCAAGCTTTCTAGACCAT

BO18856.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 14:47:45 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG34291-RA 267 CG34291-RA 69..167 115..17 495 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26427961..26428102 115..256 710 100 Plus
3R 32079331 3R 26425390..26425488 17..115 495 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:47:44 has no hits.

BO18856.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:37:43 Download gff for BO18856.complete
Subject Subject Range Query Range Percent Splice Strand
CG31084-RA 37..276 17..258 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:33:11 Download gff for BO18856.complete
Subject Subject Range Query Range Percent Splice Strand
CG34291-RA 69..167 17..115 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:52:58 Download gff for BO18856.complete
Subject Subject Range Query Range Percent Splice Strand
CG34291-RA 69..167 17..115 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:52:58 Download gff for BO18856.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26425390..26425488 17..115 100 -> Plus
3R 26427962..26428102 116..258 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:33:11 Download gff for BO18856.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22251112..22251210 17..115 100 -> Plus
arm_3R 22253684..22253824 116..258 98   Plus

BO18856.pep Sequence

Translation from 16 to 274

> BO18856.pep
MVRFAVHLLPSFLNGAGQLLAETVMAMRAKMKMPRTAVWFLALNPLLMPG
GFFLPVDAVATSGIDFGKIVARQAHFEAHQASFLDH
Sequence BO18856.pep has no blast hits.