Clone BO18931 Report

Search the DGRC for BO18931

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:189
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptCG3566-RC
Protein status:BO18931.pep: Imported from assembly
Sequenced Size:301

Clone Sequence Records

BO18931.complete Sequence

301 bp assembled on 2010-10-05

GenBank Submission: KX794539

> BO18931.complete
GAAGTTATCAGTCGACATGAGCAAGGAAATCCGTTTGGCCACCGTCAACG
AACACAACAAAGCCACGGATCTGTGGGTGGTCATCGACAACAAGGTCTAC
GATGTGACCAAGTTCCGTCTCGAGCATCCCGGTGGCGAGGAATCCCTGGT
GGATGAGGCCGGTCGCGATGCCACCAAGGCCTTCAATGACGTGGGTCACA
GCTCGGAGGCGAGAGAGATGTTGAAGAAATACTACATTGGTGACCTGGCT
GCTGCGGACATCAAGAAGAAAAGCCCAATTAGGGCAAGCTTTCTAGACCA
T

BO18931.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-RC 270 CG3566-PC 1..267 17..283 1335 100 Plus
CG3566-RD 321 CG3566-PD 1..266 17..282 1330 100 Plus
CG3566-RB 354 CG3566-PB 1..266 17..282 1330 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:21:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-RC 1607 CG3566-RC 86..352 17..283 1335 100 Plus
CG3566-RD 770 CG3566-RD 86..351 17..282 1330 100 Plus
CG3566-RB 550 CG3566-RB 86..351 17..282 1330 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6276532..6276639 124..17 540 100 Minus
X 23542271 X 6276370..6276465 213..118 465 99 Minus
X 23542271 X 6276227..6276298 283..212 360 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:21:31 has no hits.

BO18931.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-05 13:04:47 Download gff for BO18931.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RC 40..306 17..285 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:45 Download gff for BO18931.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RC 86..352 17..285 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:16:15 Download gff for BO18931.complete
Subject Subject Range Query Range Percent Splice Strand
CG3566-RC 86..352 17..285 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:16:15 Download gff for BO18931.complete
Subject Subject Range Query Range Percent Splice Strand
X 6276224..6276296 214..285 97 <- Minus
X 6276370..6276458 125..213 100 <- Minus
X 6276532..6276639 17..124 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:45 Download gff for BO18931.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 6170257..6170329 214..285 97 <- Minus
arm_X 6170403..6170491 125..213 100 <- Minus
arm_X 6170565..6170672 17..124 100   Minus

BO18931.pep Sequence

Translation from 16 to 301

> BO18931.pep
MSKEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGR
DATKAFNDVGHSSEAREMLKKYYIGDLAAADIKKKSPIRASFLDH

BO18931.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG3566-PC 89 CG3566-PC 1..89 1..89 457 100 Plus
CG3566-PD 106 CG3566-PD 1..94 1..94 457 95.7 Plus
CG3566-PB 117 CG3566-PB 1..88 1..88 452 100 Plus
Cyt-b5-PB 134 CG2140-PB 6..85 2..81 235 52.5 Plus
CG6870-PB 137 CG6870-PB 43..116 4..77 205 52.7 Plus