BO18931.complete Sequence
301 bp assembled on 2010-10-05
GenBank Submission: KX794539
> BO18931.complete
GAAGTTATCAGTCGACATGAGCAAGGAAATCCGTTTGGCCACCGTCAACG
AACACAACAAAGCCACGGATCTGTGGGTGGTCATCGACAACAAGGTCTAC
GATGTGACCAAGTTCCGTCTCGAGCATCCCGGTGGCGAGGAATCCCTGGT
GGATGAGGCCGGTCGCGATGCCACCAAGGCCTTCAATGACGTGGGTCACA
GCTCGGAGGCGAGAGAGATGTTGAAGAAATACTACATTGGTGACCTGGCT
GCTGCGGACATCAAGAAGAAAAGCCCAATTAGGGCAAGCTTTCTAGACCA
T
BO18931.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:21:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3566-RC | 270 | CG3566-PC | 1..267 | 17..283 | 1335 | 100 | Plus |
CG3566-RD | 321 | CG3566-PD | 1..266 | 17..282 | 1330 | 100 | Plus |
CG3566-RB | 354 | CG3566-PB | 1..266 | 17..282 | 1330 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:21:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3566-RC | 1607 | CG3566-RC | 86..352 | 17..283 | 1335 | 100 | Plus |
CG3566-RD | 770 | CG3566-RD | 86..351 | 17..282 | 1330 | 100 | Plus |
CG3566-RB | 550 | CG3566-RB | 86..351 | 17..282 | 1330 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:21:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 6276532..6276639 | 124..17 | 540 | 100 | Minus |
X | 23542271 | X | 6276370..6276465 | 213..118 | 465 | 99 | Minus |
X | 23542271 | X | 6276227..6276298 | 283..212 | 360 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 08:21:31 has no hits.
BO18931.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-05 13:04:47 Download gff for
BO18931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3566-RC | 40..306 | 17..285 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:33:45 Download gff for
BO18931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3566-RC | 86..352 | 17..285 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:16:15 Download gff for
BO18931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3566-RC | 86..352 | 17..285 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:16:15 Download gff for
BO18931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 6276224..6276296 | 214..285 | 97 | <- | Minus |
X | 6276370..6276458 | 125..213 | 100 | <- | Minus |
X | 6276532..6276639 | 17..124 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:33:45 Download gff for
BO18931.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 6170257..6170329 | 214..285 | 97 | <- | Minus |
arm_X | 6170403..6170491 | 125..213 | 100 | <- | Minus |
arm_X | 6170565..6170672 | 17..124 | 100 | | Minus |
BO18931.pep Sequence
Translation from 16 to 301
> BO18931.pep
MSKEIRLATVNEHNKATDLWVVIDNKVYDVTKFRLEHPGGEESLVDEAGR
DATKAFNDVGHSSEAREMLKKYYIGDLAAADIKKKSPIRASFLDH
BO18931.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:35:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3566-PC | 89 | CG3566-PC | 1..89 | 1..89 | 457 | 100 | Plus |
CG3566-PD | 106 | CG3566-PD | 1..94 | 1..94 | 457 | 95.7 | Plus |
CG3566-PB | 117 | CG3566-PB | 1..88 | 1..88 | 452 | 100 | Plus |
Cyt-b5-PB | 134 | CG2140-PB | 6..85 | 2..81 | 235 | 52.5 | Plus |
CG6870-PB | 137 | CG6870-PB | 43..116 | 4..77 | 205 | 52.7 | Plus |