Clone BO19679 Report

Search the DGRC for BO19679

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:196
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptRpS18-RA
Protein status:BO19679.pep: Imported from assembly
Sequenced Size:490

Clone Sequence Records

BO19679.complete Sequence

490 bp assembled on 2009-05-13

GenBank Submission: KX793999

> BO19679.complete
GAAGTTATCAGTCGACATGTCGCTCGTCATCCCAGAGAAGTTCCAGCACA
TCCTGCGTATCATGAATACGAACATCGACGGCAAGCGCAAGGTTGGCATC
GCCATGACCGCCATCAAGGGAGTGGGTCGCCGCTACTCCAACATTGTGCT
GAAGAAGGCCGATGTCGATCTTACCAAGCGCGCCGGTGAGTGCACCGAGG
AGGAGGTCGACAAGGTGGTGACCATCATCTCGAACCCTCTGCAGTACAAG
GTGCCCAACTGGTTCCTCAACAGGCAGAAGGACATCATCGATGGCAAGTA
CTGGCAGCTGACCTCCTCCAACTTGGACTCGAAGCTGCGTGACGATCTGG
AGCGTCTGAAGAAGATCCGCTCCCACCGTGGTCTGCGTCACTACTGGGGC
CTCCGTGTGCGTGGCCAGCACACCAAGACCACCGGTCGTCGTGGTCGCAC
CGTGGGTGTGTCCAAGAAGAAGGCAAGCTTTCTAGACCAT

BO19679.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
RpS18-RA 459 CG8900-PA 1..456 17..472 2280 100 Plus
RpS18-RB 459 CG8900-PB 1..456 17..472 2280 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
RpS18-RA 583 CG8900-RA 39..494 17..472 2280 100 Plus
RpS18-RB 606 CG8900-RB 62..517 17..472 2280 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20264491..20264759 204..472 1345 100 Plus
2R 25286936 2R 20264246..20264434 19..207 945 100 Plus
Blast to na_te.dros performed on 2014-11-27 19:38:38 has no hits.

BO19679.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:41:22 Download gff for BO19679.complete
Subject Subject Range Query Range Percent Splice Strand
RpS18-RB 58..513 17..474 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:01:40 Download gff for BO19679.complete
Subject Subject Range Query Range Percent Splice Strand
RpS18-RB 62..517 17..474 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:05:29 Download gff for BO19679.complete
Subject Subject Range Query Range Percent Splice Strand
RpS18-RB 62..517 17..474 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:05:29 Download gff for BO19679.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20264245..20264432 17..205 99 -> Plus
2R 20264493..20264759 206..474 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:01:40 Download gff for BO19679.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16151750..16151937 17..205 99 -> Plus
arm_2R 16151998..16152264 206..474 99   Plus

BO19679.pep Sequence

Translation from 16 to 490

> BO19679.pep
MSLVIPEKFQHILRIMNTNIDGKRKVGIAMTAIKGVGRRYSNIVLKKADV
DLTKRAGECTEEEVDKVVTIISNPLQYKVPNWFLNRQKDIIDGKYWQLTS
SNLDSKLRDDLERLKKIRSHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSK
KKASFLDH

BO19679.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:22:20
Subject Length Description Subject Range Query Range Score Percent Strand
RpS18-PA 152 CG8900-PA 1..152 1..152 789 100 Plus
RpS18-PB 152 CG8900-PB 1..152 1..152 789 100 Plus