BO19816.complete Sequence
349 bp assembled on 2009-05-13
GenBank Submission: KX795821
> BO19816.complete
GAAGTTATCAGTCGACATGAAATTCCTGATTGTCTTCGTCGCCCTCTTCG
CCGTGGCTCTGGCTGCTCCTGCCGCTGAGGAACCCACAATCGTGCGCTCT
GAATCCGACGTTGGACCCGAAAGCTTCAAATACGACTGGGAAACCTCCGA
TGGACAGGCTGCTCAAGCTGTAGGTCAGCTGAACGACATTGGAACTGAGA
ACGAGGCTATCTCTGTGAGTGGATCCTACCGCTTCATTGCTGATGATGGC
CAGACCTACCAAGTCAACTACATCGCCGATAAGAACGGATTCCAGCCCGA
GGGTGCTCATCTGCCCGTTGCCCCCGTGGCAGCAAGCTTTCTAGACCAT
BO19816.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:35:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Lcp65Ag3-RA | 318 | CG18779-PA | 1..315 | 17..331 | 1575 | 100 | Plus |
Lcp65Ag1-RA | 318 | CG10530-PA | 1..315 | 17..331 | 1560 | 99.7 | Plus |
Lcp65Ag2-RA | 318 | CG10534-PA | 1..314 | 17..330 | 1555 | 99.7 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:35:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Lcp65Ag3-RA | 543 | CG18779-RA | 60..375 | 16..331 | 1580 | 100 | Plus |
Lcp65Ag1-RA | 517 | CG10530-RA | 61..376 | 16..331 | 1565 | 99.7 | Plus |
Lcp65Ag2-RA | 543 | CG10534-RA | 61..375 | 16..330 | 1560 | 99.7 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:35:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 6130554..6130749 | 331..136 | 980 | 100 | Minus |
3L | 28110227 | 3L | 6134838..6135033 | 331..136 | 965 | 99.5 | Minus |
3L | 28110227 | 3L | 6133158..6133352 | 330..136 | 960 | 99.5 | Minus |
3L | 28110227 | 3L | 6130811..6130930 | 135..16 | 600 | 100 | Minus |
3L | 28110227 | 3L | 6133414..6133533 | 135..16 | 600 | 100 | Minus |
3L | 28110227 | 3L | 6135095..6135214 | 135..16 | 600 | 100 | Minus |
3L | 28110227 | 3L | 6137725..6137826 | 322..221 | 390 | 92.2 | Minus |
3L | 28110227 | 3L | 6150441..6150524 | 327..244 | 300 | 90.5 | Minus |
3L | 28110227 | 3L | 6147570..6147653 | 327..244 | 300 | 90.5 | Minus |
3L | 28110227 | 3L | 6145194..6145289 | 221..316 | 300 | 87.5 | Plus |
3L | 28110227 | 3L | 6136385..6136555 | 329..159 | 255 | 76.6 | Minus |
3L | 28110227 | 3L | 6136699..6136742 | 58..15 | 190 | 95.5 | Minus |
Blast to na_te.dros performed on 2014-11-28 00:35:28 has no hits.
BO19816.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:40:48 Download gff for
BO19816.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Lcp65Ag3-RA | 58..372 | 17..333 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:55:17 Download gff for
BO19816.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Lcp65Ag3-RA | 61..375 | 17..333 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:23:07 Download gff for
BO19816.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Lcp65Ag3-RA | 61..375 | 17..333 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:23:07 Download gff for
BO19816.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 6130552..6130749 | 136..333 | 98 | <- | Minus |
3L | 6130811..6130929 | 17..135 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:55:17 Download gff for
BO19816.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 6123652..6123849 | 136..333 | 98 | <- | Minus |
arm_3L | 6123911..6124029 | 17..135 | 100 | | Minus |
BO19816.pep Sequence
Translation from 16 to 349
> BO19816.pep
MKFLIVFVALFAVALAAPAAEEPTIVRSESDVGPESFKYDWETSDGQAAQ
AVGQLNDIGTENEAISVSGSYRFIADDGQTYQVNYIADKNGFQPEGAHLP
VAPVAASFLDH
BO19816.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:21:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Lcp65Ag3-PA | 105 | CG18779-PA | 1..105 | 1..105 | 535 | 100 | Plus |
Lcp65Ag1-PA | 105 | CG10530-PA | 1..105 | 1..105 | 532 | 99 | Plus |
Lcp65Ag2-PA | 105 | CG10534-PA | 1..105 | 1..105 | 532 | 99 | Plus |
Lcp65Af-PA | 100 | CG10533-PA | 1..99 | 1..104 | 348 | 63.5 | Plus |
Lcp65Ae-PA | 99 | CG10529-PA | 1..98 | 1..102 | 346 | 66.7 | Plus |