Clone BO19820 Report

Search the DGRC for BO19820

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:198
Well:20
Vector:pDNR-Dual
Associated Gene/TranscriptTpnC47D-RA
Protein status:BO19820.pep: Imported from assembly
Sequenced Size:499

Clone Sequence Records

BO19820.complete Sequence

499 bp assembled on 2009-05-13

GenBank Submission: KX798785

> BO19820.complete
GAAGTTATCAGTCGACATGGATAACATTGACGAAGACCTGACCCCCGAGC
AGATTGCCGTTCTGCAGAAGGCATTCAACAGCTTCGACCACCAGAAGACC
GGCAGTATCCCCACCGAAATGGTGGCCGATATCCTCCGTCTTATGGGTCA
GCCCTTCGACAGGCAGATCCTTGACGAGCTGATCGACGAGGTCGATGAGG
ACAAATCCGGTCGCCTGGAGTTCGAGGAGTTCGTCCAGCTGGCTGCCAAG
TTCATCGTAGAGGAGGATGATGAGGCCATGCAGAAGGAGCTGCGCGAGGC
TTTCCGTCTGTACGACAAGCAGGGCAATGGCTACATTCCCACCTCCTGCC
TGAAGGAGATCCTCAAGGAACTGGACGACCAGCTGACCGAACAGGAGCTC
GACATCATGATTGAGGAAATCGATTCCGACGGCTCTGGCACCGTTGATTT
TGATGAATTCATGGAGATGATGACTGGCGAGGCAAGCTTTCTAGACCAT

BO19820.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC47D-RB 468 CG9073-PB 1..465 17..481 2325 100 Plus
TpnC47D-RA 468 CG9073-PA 1..465 17..481 2325 100 Plus
TpnC73F-RC 468 CG7930-PC 16..465 32..481 1515 89.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC47D-RB 791 CG9073-RB 55..519 17..481 2325 100 Plus
TpnC47D-RA 601 CG9073-RA 55..519 17..481 2325 100 Plus
TpnC73F-RC 1059 CG7930-RC 210..659 32..481 1515 89.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11274580..11274831 455..204 1260 100 Minus
3L 28110227 3L 17047352..17047601 206..455 905 90.8 Plus
2R 25286936 2R 11274890..11275064 203..29 875 100 Minus
3L 28110227 3L 17046344..17046460 32..148 300 83.8 Plus
3L 28110227 3L 17046522..17046579 146..203 200 89.7 Plus
2L 23513712 2L 5218651..5218773 242..364 195 77.2 Plus
Blast to na_te.dros performed on 2014-11-27 23:58:48 has no hits.

BO19820.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:40:46 Download gff for BO19820.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC47D-RA 60..524 17..483 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:42:54 Download gff for BO19820.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC47D-RA 55..519 17..483 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:12:04 Download gff for BO19820.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC47D-RA 55..519 17..483 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:12:04 Download gff for BO19820.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11274580..11274831 204..455 100 <- Minus
2R 11274890..11275064 29..203 100 <- Minus
2R 11274115..11274142 456..483 92 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:42:54 Download gff for BO19820.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7162085..7162336 204..455 100 <- Minus
arm_2R 7162395..7162569 29..203 100 <- Minus
arm_2R 7161620..7161647 456..483 92 <- Minus

BO19820.pep Sequence

Translation from 16 to 499

> BO19820.pep
MDNIDEDLTPEQIAVLQKAFNSFDHQKTGSIPTEMVADILRLMGQPFDRQ
ILDELIDEVDEDKSGRLEFEEFVQLAAKFIVEEDDEAMQKELREAFRLYD
KQGNGYIPTSCLKEILKELDDQLTEQELDIMIEEIDSDGSGTVDFDEFME
MMTGEASFLDH

BO19820.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC47D-PB 155 CG9073-PB 1..155 1..155 788 100 Plus
TpnC47D-PA 155 CG9073-PA 1..155 1..155 788 100 Plus
TpnC73F-PC 155 CG7930-PC 1..155 1..155 739 92.9 Plus
TpnC73F-PA 155 CG7930-PA 1..155 1..155 739 92.9 Plus
TpnC41C-PB 154 CG2981-PB 1..151 4..154 498 64.2 Plus